KEGG   Geobacter sp. M18: GM18_2199Help
Entry
GM18_2199         CDS       T01421                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
geb  Geobacter sp. M18
Pathway
geb00010  Glycolysis / Gluconeogenesis
geb00052  Galactose metabolism
geb00500  Starch and sucrose metabolism
geb00520  Amino sugar and nucleotide sugar metabolism
geb00521  Streptomycin biosynthesis
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01120  Microbial metabolism in diverse environments
geb01130  Biosynthesis of antibiotics
geb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM18_2199
   00052 Galactose metabolism
    GM18_2199
   00500 Starch and sucrose metabolism
    GM18_2199
   00520 Amino sugar and nucleotide sugar metabolism
    GM18_2199
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GM18_2199
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GM18_2199
Enzymes [BR:geb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GM18_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADW13659
JGI: GM18_2199
UniProt: E8WLH9
Position
complement(2649207..2650190)
Genome map
AA seq 327 aa AA seqDB search
MLILAGDVGGTSTRLAYFEGDAAGFSMLAQAQYQSAAHGSLVEIVRRFADQHGVAAEGAC
FGIAGPIIEGKVRTPNLPWTIDGVELALALRLPRVRLINDLEANTYGIASLKQEDLLTLN
PGTPRPDGTIAVVSAGTGLGESLAYWDGDTHRPLPSEAGHADFAARSDLETELLLYLQAK
HGRVSYERVLSGPGLLDIYRFLRDKRYFPEHPSIVAAMNAEDPPAVITRAALEGSCPMCG
KALDMFISVYGAEAGNAALRFLATGGVYLGGGIAPKIVELLKGATFMVAFTAKGRLSPLV
QSIPVHVILNESTALLGAGRAAFYAPR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcctggcgggagatgtgggagggacctcgacgcggctggcttactttgagggg
gacgccgcagggttcagcatgctggcccaggcgcagtaccagagtgccgcccacggcagt
ctggtcgagatcgtacgccgcttcgccgaccagcatggtgtcgcggccgaaggtgcctgc
ttcgggatcgccgggccgatcatcgagggaaaggtccgcacgccgaacctcccgtggacc
atcgacggcgtggaactggccctcgccttgcggcttccccgggtgcgcctgatcaacgac
ctggaggccaacacctacgggatcgcctcgctcaagcaggaggacctgctgacgctcaat
cccggcactccacgcccggacgggaccatagccgtggtgtcggcggggacaggcctcggg
gaatccctggcctactgggacggcgatacccaccggccgctccccagcgaggccgggcac
gcagacttcgcggcgcgaagcgatctggagacggagctgcttctgtacctgcaggcgaaa
cacgggcgggtgagctacgagagggtcctgtccggtcccggcctcctcgatatctaccgt
ttcctgcgtgacaagcgctactttcccgagcacccctccatcgtagccgccatgaacgcg
gaagacccgcccgcagtcattacccgcgccgcccttgagggaagctgccccatgtgcggc
aaggccctcgacatgttcatctccgtctacggcgccgaagcaggcaacgccgccctcagg
ttcctggccacggggggcgtttatctggggggcggaatcgcgccgaagatcgtagaactc
ctcaagggggcgaccttcatggtcgcctttaccgcaaaaggaaggcttagtccactggtg
caatcgattccggtgcacgtgatactaaatgaaagcaccgcgcttcttggtgcaggcaga
gcggctttttatgctccgcgttaa

DBGET integrated database retrieval system