KEGG   Geobacter sp. M18: GM18_2260Help
Entry
GM18_2260         CDS       T01421                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
geb  Geobacter sp. M18
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:geb00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2724441..2725073
Genome map
AA seq 210 aa AA seqDB search
MQRRSALLVVDVQVDFCPGGALPVPDGDQVVQPLNRYLELFSQKSAPIFASRDWHPEKSK
HFREQGGAWPPHCIQGTEGAQFHPGLQLPKGTIVISKGIAEWDNGYSALQGVTENGTPFT
MLLRRMKLDRLYVGGLATDYCVKASVLEALNEGFAVTLLTDAIRGVELKPGDSDRALQAM
IEAGAREATFASVPGALLANGNGAGHAGGG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcaacggaggtccgcccttctcgtggtcgatgtgcaggtcgatttctgccccggcggt
gcactgcctgtcccggacggcgaccaggtggtgcagccgctgaaccggtatctggagctc
ttcagccagaagagcgcgccgatcttcgcctccagggactggcatccggaaaagagcaaa
cacttccgggaacagggcggggcctggccaccgcactgcatccagggaacggagggggcg
cagttccatccggggttgcagctgccgaaagggaccatcgtcatctcgaaggggatcgca
gagtgggacaacggctattcggccctgcaaggggtcacggaaaacggcacgccgttcacg
atgcttttgcgccgcatgaagctggaccggctttacgtgggggggctcgccaccgactat
tgcgtcaaggcatcggtactggaagcgctcaacgaggggtttgccgtgacgcttctcacc
gatgccatacgcggagtcgaacttaagccgggtgattcggatcgggcattgcaagcgatg
atcgaggccggcgcccgggaggccaccttcgcatcggtgcctggcgcccttctcgcaaac
ggcaacggcgcgggccacgccggtggcggctaa

DBGET integrated database retrieval system