KEGG   Geobacter sp. M18: GM18_2264Help
Entry
GM18_2264         CDS       T01421                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
geb  Geobacter sp. M18
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GM18_2264
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GM18_2264
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GM18_2264
Enzymes [BR:geb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GM18_2264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2729121..2730476)
Genome map
AA seq 451 aa AA seqDB search
MNTKFLLDESRIPKQWYNIIPDMPGPLYPVINPQTLKPVVPEDMAAIFPMSIIEQEMSNE
RWIDIPEEVREKYKMWRPSPLFRARGLEKALQTPAKIYYKYEGVSPAGSHKPNSAIPQAY
YNKQAGIRRLATETGAGQWGSSLALACSMFGLECTIYMVKVSCTQKPYRKSMMQLWGATV
IPSPSEFTNAGRTILAHDPDNLGSLGIAISEAVEDAATHADTNYALGSVLNHVCLHQTVI
GLEAKEQMALAQDYPDVVIACCGGGSNFAGLAFPFLMDRASGKKVRCLAVEPASCPTLTK
GVYAFDYGDTAKLAPITKMYTLGHDFMPPGIHAGGLRYHGDSALISQLYHAGEIEAKAYK
QNACFEGALLFARTEGIVPAPESSHALRAAIDEAVLAKEEGKEKTILFGLSGHGQLDMAA
YNAYLSGQLEDFEYPEEMIRQSLERLPKVCL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaagtttttgcttgatgaatcgcgcatcccgaagcagtggtacaacatcatt
cccgacatgccgggtccgctgtatccggtgatcaacccgcagaccctgaagccggtggtt
cctgaagacatggccgccatcttcccgatgtcgatcatcgagcaggagatgtccaacgag
cgctggatcgacatccccgaagaggtgcgcgagaaatacaagatgtggcgcccgtcgccg
ctgttccgtgcccgcgggctggaaaaggcgctgcagacgccggctaagatctactacaag
tacgagggggtctcccccgccggctcccacaagcccaactccgccatcccgcaggcctac
tacaacaagcaggccgggatccgcaggctcgccaccgagaccggagcggggcagtggggg
agctcgctcgctctcgcctgctccatgttcggcctggagtgcaccatctacatggtgaag
gtctcctgcacacagaagccgtaccgaaagagcatgatgcagctctggggggccacggtg
atcccgtccccgtccgagttcaccaacgccgggcgcaccatcctggcgcacgacccggac
aacctggggagcctggggatcgccatctccgaggccgtcgaggacgccgccacccatgcc
gacaccaactacgccctcgggagcgtcctgaaccacgtctgcctgcaccagaccgtgatc
ggcctggaggccaaggagcagatggcgctggcccaggactacccggacgtggtgatcgcc
tgctgcggaggcggctccaacttcgcggggcttgcctttccgtttctcatggaccgggcc
agcggcaagaaggtgcgctgcctggcagtcgagccggcctcctgcccgaccctgaccaag
ggggtttacgcattcgactacggcgatacggcgaagctcgccccgatcaccaagatgtac
accctggggcacgacttcatgccgccggggatccatgccggcgggctgcgctaccacggc
gactcggcgctcatctcccagctctaccacgccggcgagatcgaggcgaaggcgtacaag
cagaacgcctgcttcgagggggcgctgctctttgcgaggaccgaagggatcgtgcctgcg
cctgaatcgtcgcacgcgctgcgcgccgccatcgacgaggcggtgctcgccaaggaagag
gggaaggagaagaccatcctcttcgggctctcgggccacggccagctggacatggcggcc
tacaacgcctacctatccgggcagctggaagacttcgagtaccccgaggagatgatccgt
cagtccctggagaggttgcccaaggtctgcctgtga

DBGET integrated database retrieval system