KEGG   Geobacter sp. M18: GM18_2306Help
Entry
GM18_2306         CDS       T01421                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
geb  Geobacter sp. M18
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:geb01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:geb01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:geb00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:geb00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:geb00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:geb00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:geb00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2783594..2784553
Genome map
AA seq 319 aa AA seqDB search
MKKIGILTSGGDCSGMNAAIRSATRTALGHGVQVLGFRKGYAGLLKGDFLEMASKDVAGI
LHRGGTFLQSARSEEFRTVLGREKAVRHLQDFGVEGLIVIGGDGSLNGALALHRMGVPVI
GIPASIDNDIAYTDMALGVDTALNNIIYAVDCIKDTASSHDRAFVIEVMGRNSGYLASMS
AIATGAEYAIVPEVECDIADLCNQLRKRYEEGRSNAIIILAEGAGRAQNIADNIKDAIGF
ETRVTVLGHYQRGGAPSVFDRLLGSRFGHAAAEQLLAGEKGKMVGLCCNELCLTALETVV
VSEKPQQDELHELSMVLGI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagataggtattctcaccagcggcggggactgctccggcatgaacgcggccatc
aggagcgcgacccgaaccgcactcggacacggggtgcaggtgctgggtttcaggaaaggg
tacgccggcctgttgaagggtgacttcctggagatggcgagcaaggacgtggcggggatt
ctgcaccgcggcggcaccttcctgcagtcggccaggagcgaggagttccgcaccgtgctc
gggcgcgagaaggcggtgcgccacctgcaggatttcggggtcgaggggctcatcgtgatc
ggcggcgacggctcgctaaacggcgccctggcgctgcaccgcatgggggtcccggtgatc
gggatcccggccagcatcgacaacgacatcgcctacaccgacatggccctcggcgtcgac
accgcgctcaacaacatcatctacgccgtggactgcatcaaggacaccgcgagctcgcac
gaccgcgccttcgtcatcgaggtgatggggagaaactccggatacctcgccagcatgagc
gccatcgccaccggcgccgagtatgccatcgtcccagaggtcgagtgcgacatagcggat
ctgtgcaaccagctcaggaaacgctacgaggaggggcgcagcaacgccatcatcatcctc
gccgaaggggccgggcgggcgcagaatatcgccgacaacatcaaggacgccatcggcttc
gagacccgcgtgaccgtgctcgggcactaccagcgcggcggtgccccttccgtcttcgac
cggctcctgggaagccgcttcggccacgcggcggcggagcagctcctggcgggcgaaaag
gggaagatggtggggctttgctgcaacgagctctgccttacggcgctggaaacggtggtg
gtgagcgagaaaccccagcaggacgagttgcacgaactctccatggttctcgggatctga

DBGET integrated database retrieval system