KEGG   Geobacter sp. M18: GM18_2321Help
Entry
GM18_2321         CDS       T01421                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 35-epimerase related protein
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
geb  Geobacter sp. M18
Pathway
geb00521  Streptomycin biosynthesis
geb00523  Polyketide sugar unit biosynthesis
geb01130  Biosynthesis of antibiotics
Module
geb_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    GM18_2321
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GM18_2321
Enzymes [BR:geb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     GM18_2321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_1 FdtA GPI Cupin_2
Motif
Other DBs
NCBI-ProteinID: ADW13780
JGI: GM18_2321
UniProt: E8WMH0
Position
complement(2796483..2796971)
Genome map
AA seq 162 aa AA seqDB search
MKDVQRFNKGRIHDVVCKPLTKFLDERGWLTELFRNDELDPDIAPVMSYISMTQPGVARG
PHEHLDQTDYFCFLGPSNFKVYLWDARPGSPTFGVKQVVYAGVDAPTMMVVPPGVVHAYR
NIGMENGIVFNAPNRLFAGKGKREPVDEIRHEESGDSPFQLD
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtgcagcgcttcaacaaggggcggatccacgacgtggtctgcaagccgctg
accaagttcctggacgagagaggttggctcaccgagctgttccgcaacgacgaactcgat
ccggacatcgcgccggtgatgtcgtacatctcgatgacccagccgggagtggcccgcggg
ccgcacgagcacctggaccagaccgactacttctgcttcctcggcccctcgaacttcaag
gtctacctctgggacgcgcgtcccggctccccgaccttcggggtgaagcaggtggtttac
gccggggtggacgcccccacgatgatggtggtaccgccgggtgtcgtgcacgcctaccgc
aacatcggcatggagaacggcatcgtcttcaacgcccccaacaggcttttcgccggaaag
ggcaagcgcgagccggtcgacgagatacgccacgaggagagcggggattccccgttccag
ctcgactga

DBGET integrated database retrieval system