KEGG   Geobacter sp. M18: GM18_2517Help
Entry
GM18_2517         CDS       T01421                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
geb  Geobacter sp. M18
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:geb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3012929..3013765)
Genome map
AA seq 278 aa AA seqDB search
MIPAATWELSRRTLSLERPQIMGILNVTPDSFSDGGRFFSLEASVERAREMEREGADIID
IGGESTRPNAPAVTLAQELDRVIPVIEALKGRISVPISIDTYKAGVAKAACAAGAEIVND
VTGLMFDPEMAAVVAEAGAGLVVMHTRGMPDTMQKDTGYDDLIADVKEYLARSIALAKSA
GLPEGRIVIDPGLGFGKSVQGNLELIKRLKEFLELGRPILVGPSRKSFIGAVTGREGGER
IFGTAAAVAMSIVHGAAILRVHDVAAMKDVAVMARALM
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatacccgctgcaacgtgggagctttcccgacgcaccctgtccctggagcgtccgcag
atcatgggcatattgaacgtgactccggactccttctcggacggggggcgtttcttctcc
ctggaggcctccgtggagcgggcccgggagatggagcgggagggggccgacatcatcgac
atcggcggcgaaagcacccggcccaacgcacctgccgtgacgctcgcgcaggaactggac
cgggtgattcccgttatagaggcgctcaaaggacgcatctcggtgcccatctccatagac
acctacaaggccggtgtggcgaaggcagcctgtgccgccggggccgagatcgtcaatgac
gtcaccggcctcatgttcgatccggagatggccgccgtggtggccgaggccggcgccggc
ctcgtggtgatgcacacccggggcatgccggacaccatgcaaaaggacaccggctacgac
gacctgatcgccgacgtgaaggagtacctggcgcgctccatagcgctggccaagtccgcc
ggacttcccgaggggcggatagtcatcgatccggggcttggtttcggcaagagcgtccag
gggaacctggagctgatcaagcggctcaaggagttcctggaactggggcgcccgatcctg
gtcggcccatcccggaagtcgttcatcggggccgtcaccggcagggaaggtggagagagg
atcttcggcactgctgccgcggtcgccatgtcgatcgtgcacggagccgccattttacgg
gtacatgacgtggctgccatgaaggacgtcgccgtcatggcgcgggccctcatgtag

DBGET integrated database retrieval system