KEGG   Geobacter sp. M18: GM18_2517Help
Entry
GM18_2517         CDS       T01421                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
geb  Geobacter sp. M18
Pathway
geb00790  Folate biosynthesis
geb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GM18_2517
Enzymes [BR:geb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     GM18_2517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADW13970
JGI: GM18_2517
UniProt: E8WPV3
Position
complement(3012929..3013765)
Genome map
AA seq 278 aa AA seqDB search
MIPAATWELSRRTLSLERPQIMGILNVTPDSFSDGGRFFSLEASVERAREMEREGADIID
IGGESTRPNAPAVTLAQELDRVIPVIEALKGRISVPISIDTYKAGVAKAACAAGAEIVND
VTGLMFDPEMAAVVAEAGAGLVVMHTRGMPDTMQKDTGYDDLIADVKEYLARSIALAKSA
GLPEGRIVIDPGLGFGKSVQGNLELIKRLKEFLELGRPILVGPSRKSFIGAVTGREGGER
IFGTAAAVAMSIVHGAAILRVHDVAAMKDVAVMARALM
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatacccgctgcaacgtgggagctttcccgacgcaccctgtccctggagcgtccgcag
atcatgggcatattgaacgtgactccggactccttctcggacggggggcgtttcttctcc
ctggaggcctccgtggagcgggcccgggagatggagcgggagggggccgacatcatcgac
atcggcggcgaaagcacccggcccaacgcacctgccgtgacgctcgcgcaggaactggac
cgggtgattcccgttatagaggcgctcaaaggacgcatctcggtgcccatctccatagac
acctacaaggccggtgtggcgaaggcagcctgtgccgccggggccgagatcgtcaatgac
gtcaccggcctcatgttcgatccggagatggccgccgtggtggccgaggccggcgccggc
ctcgtggtgatgcacacccggggcatgccggacaccatgcaaaaggacaccggctacgac
gacctgatcgccgacgtgaaggagtacctggcgcgctccatagcgctggccaagtccgcc
ggacttcccgaggggcggatagtcatcgatccggggcttggtttcggcaagagcgtccag
gggaacctggagctgatcaagcggctcaaggagttcctggaactggggcgcccgatcctg
gtcggcccatcccggaagtcgttcatcggggccgtcaccggcagggaaggtggagagagg
atcttcggcactgctgccgcggtcgccatgtcgatcgtgcacggagccgccattttacgg
gtacatgacgtggctgccatgaaggacgtcgccgtcatggcgcgggccctcatgtag

DBGET integrated database retrieval system