KEGG   Geobacter sp. M18: GM18_2553Help
Entry
GM18_2553         CDS       T01421                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
geb  Geobacter sp. M18
Brite
Enzymes [BR:geb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     GM18_2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 RrnaAD MTS
Motif
Other DBs
NCBI-ProteinID: ADW14005
JGI: GM18_2553
UniProt: E8WQL1
Position
complement(3056544..3057191)
Genome map
AA seq 215 aa AA seqDB search
MNSAVARKRMVAELVKRGITDQRVIDAMRELPRHIFVEEAMAAQAYSDGSLPIGEKQTIS
QPYIVARMTELLALTGREKVLELGTGSGYQAAVLATLADRVCTVERIRPLAMKARKALDS
LRLLNVNLKIGDGTEGWPEEAPFDAILVTAGAPFLPDCLVEQLAPGGRLVIPVGDRVDQK
LLVIRKALDGSVTREEADDCRFVRLIGKNGWSEEQ
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagctgtagcacgcaagaggatggtcgccgaactggtgaaacgcggcatcacg
gaccagcgggtgatcgacgccatgcgcgagttgcccagacacatattcgtcgaggaggcg
atggccgcccaggcgtacagcgacggctccctcccgattggtgaaaagcagaccatctcg
cagccctacatcgtggcccgcatgaccgagcttttggcgctcaccgggcgcgagaaggtg
ctggaactggggaccggttccggttaccaggccgcggtgctcgcgaccctggcggaccgg
gtctgcaccgtcgagaggatccgcccgctggcgatgaaggcgcgcaaggcgctggacagc
ctgaggcttttgaacgtgaacctgaagataggggacggcaccgaggggtggcccgaggag
gctccctttgacgccatcctggtcaccgccggggctcccttcctccctgactgcctggtt
gagcaactggccccgggggggaggctggtgattccggtcggcgaccgcgtggaccagaaa
ctgctggtgataagaaaagcgctggatggcagcgtgacccgtgaagaggccgacgactgc
cgtttcgtgaggctgatcggcaagaacggctggagtgaagagcagtag

DBGET integrated database retrieval system