KEGG   Geobacter sp. M18: GM18_2654Help
Entry
GM18_2654         CDS       T01421                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
geb  Geobacter sp. M18
Pathway
geb00900  Terpenoid backbone biosynthesis
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GM18_2654
Enzymes [BR:geb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     GM18_2654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADW14104
JGI: GM18_2654
UniProt: E8WRH5
Position
complement(3164343..3165185)
Genome map
AA seq 280 aa AA seqDB search
MEKLQLLAPAKVNYRLDVLGKRPDGYHDLRMVMQRVELCDEITISLSATPGIRVTCGRKG
VPDGPGNIAWKAADALLKLSGKETGIDISIDKRIPVAAGLGGGSSDAATVLMGVNALLEL
GLSDQRLMEIGVKLGADVPFFIFKKTALAEGIGDRLTAMESLPTLWVVLVNPGIHVSTAW
VYQNLILTTKKPATIIRDSYGSAAEVAALLSNDLEPVTCGKYPLLNELKEMLLAAGASGS
LMSGSGATVFGIFEDEEVAQKAAVDIARERGWFAVAVKTI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtggagaaactgcaacttctggcgcctgccaaggtgaactaccggctggacgtgttggga
aagagaccggacggctatcacgacctgcgcatggtcatgcagcgggtcgagctgtgcgac
gagatcaccatctccttgagcgctacccccgggatccgcgtaacctgcggcaggaaaggg
gtacccgatggaccgggcaacatagcctggaaagccgccgatgcgcttcttaagctttcc
gggaaagagaccggtatcgacatctccatcgacaagaggattccggtggcagccggcttg
ggcggggggagcagcgacgccgccaccgtgctcatgggggtgaacgcgctcctggaactc
ggactgtccgatcagcgcctcatggagataggggtgaagcttggagcggacgtcccgttt
ttcattttcaagaaaaccgcactggcagaagggatcggagaccggctcaccgccatggaa
tcgttgccgaccctctgggtggtcctggtgaaccccggcatccacgtttccaccgcctgg
gtctatcaaaatttaatattgacaaccaaaaagcccgccactataatccgcgattcatac
ggcagtgcggcagaagttgccgcgcttttgtccaacgatctcgagcccgttacctgcggg
aagtatccgctcttgaacgagctgaaggagatgctgctggccgccggtgcgagcggttcg
ctcatgtccggcagcggcgccaccgtcttcgggattttcgaggatgaggaagtggcccag
aaggcagcggtggacattgcgcgtgagcgtggttggtttgccgtagcagtgaagacgatt
tag

DBGET integrated database retrieval system