KEGG   Geobacter sp. M18: GM18_2688Help
Entry
GM18_2688         CDS       T01421                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
geb  Geobacter sp. M18
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GM18_2688
   01230 Biosynthesis of amino acids
    GM18_2688
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM18_2688
   00030 Pentose phosphate pathway
    GM18_2688
   00051 Fructose and mannose metabolism
    GM18_2688
   00052 Galactose metabolism
    GM18_2688
  Energy metabolism
   00680 Methane metabolism
    GM18_2688
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GM18_2688
Enzymes [BR:geb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GM18_2688
Protein phosphatases and associated proteins [BR:geb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GM18_2688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3203086..3204258)
Genome map
AA seq 390 aa AA seqDB search
MADRQKTVGVLTGGGDVPGLNPALKTLVTRAAEKGYRVIGIRRGWGGLLAYNRDDPDSWE
RNLMPLGRQEVRTVDRTGGTFLHTSRTNPGKVAAADVPDFLRGADFDPAVHGHHDFTQHI
LSNLEHLGIDALIPIGGDDTLSYAERLNREGFPVVAIPKTMDNDVFGTDYCIGFSTAVTR
SVNFIHNLRTSAGSHERIAVVELFGRNSGETSLISAYLAGVDRALISEVPFDVEKLALLL
QEDKKSNSSNYAMVTVSEGASMVGGQIVEYGQEDAYGHKKLGGIGVVVSEAVKQLTGSHI
IYQQLAYLMRSGAPDSLDLMVAYNFANMTMDLVCEGMSGRMVALQGGTYRHIPISTIMQG
EKRVDVAELYDTVEYRPKVRHVLGKPMFLY
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaggcagaagactgtaggcgtattgaccggcggcggagatgtgccggggctg
aacccggctctgaagaccctggtgacccgtgccgcggaaaaggggtaccgggtgatcggc
atccggcgcggctggggcgggcttttggcctacaaccgggacgaccccgattcctgggag
aggaatctcatgcctctgggccgccaggaggtgcgcaccgtcgaccgcaccggggggacc
ttcctgcacacgagccgcaccaacccgggcaaggtcgccgccgccgacgtcccggacttt
ctgcgcggcgccgatttcgaccccgccgtccacgggcaccacgacttcacgcagcacatc
ctctccaacctggagcacctggggatcgacgcgctgatccccatcggcggcgacgacacc
ttgagctacgcggagcggctgaaccgtgaggggttcccggtggtggccataccgaagacc
atggacaacgacgtcttcggcaccgactactgcatcggcttctcgaccgcggtcacgagg
agcgtcaacttcatccacaacctgcggaccagcgcaggctctcacgagcggatcgcagta
gtggaactgttcggacgcaactcgggcgagacctcgctcatctccgcctacctggccggc
gtggaccgcgccctcatctccgaggtccccttcgacgtcgagaagcttgccctgctcctg
caggaagacaagaagtccaacagcagcaactacgccatggtgaccgtctccgagggggcg
tccatggtcggcggtcagatcgtcgagtacggccaggaggacgcctacggccacaagaag
ctcggcggtatcggcgtggtggtgagcgaggcggtgaagcagctgaccggctcccacatc
atctaccagcagctcgcgtacctgatgcgcagcggggcgcccgactcgctggacctgatg
gtcgcctacaacttcgccaacatgaccatggacctggtctgcgaggggatgtcggggcgc
atggtcgcgctgcagggggggacctaccggcacattccgatcagcaccatcatgcagggg
gagaagcgggtcgacgtggcggagctctacgacaccgtcgagtaccgtcccaaggtgcgc
cacgtgctcggcaagccgatgttcctctactga

DBGET integrated database retrieval system