KEGG   Geobacter sp. M18: GM18_2734Help
Entry
GM18_2734         CDS       T01421                                 

Definition
alpha amylase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
geb  Geobacter sp. M18
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GM18_2734
Enzymes [BR:geb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GM18_2734
Exosome [BR:geb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GM18_2734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3255353..3257167)
Genome map
AA seq 604 aa AA seqDB search
MSKETNIKEKELKGKRSEGMGATPHTGGVGFRVWAPHATRVSVIGAFNDWDGAKNPLQAE
ENGNWYADVPGAKIGDPYKFLLTTEKGEFKRIDPYAREVTGSTGDAVVHDPSFDWGDDFH
LAPWNELVIYELHAGTFNDQEDDNAAAQFDSIAARLGHLKKLGVNAIQIMPVGEFAGDRS
WGYNPAHIFSVELSYGGPLAFKRFVKRAHSQGIAVILDVVYNHLGPSDLDLWQFDGWSEN
GLGGIYFYNDGRSHTPWGETRPNYGVGEVRQFISDNVFMWLQEYHVDGLRYDCTQFIRSI
DGAVENDLPEGWSLLQWLNEQVAQQFPGRIIIAEDLQNNNWLTKSVGAGGAGFGSQWDAH
FVHPIRQAVITPDDQERSLSAVRDALCYRYNDDAFDRVIYSESHDEVANGKARVPQEINP
GDPKGWFAQKRSTLAAALVFTAPGIPMLFQGQEFLEGEWFRDTVPLDWDQRDEFRGIVRL
YRDLIHLRLNRAGFTRGLCGQFTQVHHLNEEAKVIAFHRWDQGGAGDDVVVVANFLGEPQ
EGYVVGFPAEGTWKLRFNSDWQGYSEAFADHPSSDASAETGECDGLPCHAAISLGPYSVL
IFSQ
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagagaccaatatcaaggagaaagagctcaaggggaaaaggagcgaggggatg
ggggcgaccccgcacacggggggagtcgggttccgcgtctgggccccgcatgcaacgcgg
gtatcggtcatcggggcgtttaatgactgggacggcgccaagaacccgctgcaggccgag
gagaatggcaactggtatgccgatgtgccgggggccaaaatcggcgatccctacaagttc
ctgctcactaccgaaaagggcgagttcaagcgcatcgacccctacgcccgcgaggtgacc
ggttcgaccggcgacgcagtggtccacgatccgagctttgactggggcgacgactttcac
ctggctccctggaacgagttggtcatctacgagttgcatgccgggactttcaacgaccag
gaggatgacaacgcggccgcccagttcgactcgatcgcggcccgcctcggacatctgaaa
aagctcggcgtcaacgccatccagatcatgccggtgggcgagtttgccggcgaccggtcc
tggggttacaaccccgcccatatcttctccgtcgaactgagctacggagggcccctggcc
ttcaagcgtttcgtcaaacgcgcccacagccaagggatcgcggtgatcctcgacgtggtc
tacaaccacctgggcccaagcgacctcgatctgtggcagttcgacggctggtccgagaac
gggctgggcggcatctacttctacaacgacggccggtcccacaccccctggggggagacc
cgccccaattacggcgtgggcgaggtgcgccagttcatatccgacaatgtgttcatgtgg
cttcaggaataccacgtggacgggttgcgctacgactgcacccagttcatcaggagtatc
gacggggcagtcgaaaacgaccttcccgaggggtggagtctcctgcagtggctgaacgaa
caggtcgcccagcagttccccggccgcatcatcatcgccgaggacctgcagaacaacaac
tggctcaccaagtccgtgggtgccgggggcgccggcttcggatcacagtgggacgcccac
ttcgtgcatcccatacgccaggcggtgataacccccgacgaccaagagcgctcgctttcc
gccgtccgcgacgccctttgttaccgctacaacgacgacgccttcgatcgggtcatctac
agcgaaagtcacgacgaggtggccaacggcaaggctcgcgtgccgcaggagataaacccc
ggggaccccaagggatggttcgcccagaaacgctcgaccctggccgccgccctggtcttc
acggctcccggcataccgatgctgttccaggggcaggagtttctcgaaggggagtggttc
cgggacacggtcccgctggactgggatcagcgcgacgagttccgcggcatcgtccggctc
taccgggacctgatccatctgcggctcaaccgcgctggtttcacccgcggcctgtgcggg
cagttcacccaggtgcatcacttgaacgaggaggccaaggtcatcgccttccaccgctgg
gaccagggtggagcgggggacgacgtcgttgtggtcgccaatttcctcggagagccgcag
gagggctacgttgtcggcttcccggccgaagggacctggaagctgcgcttcaacagcgat
tggcagggctacagcgaagccttcgctgaccatccgagcagcgacgccagtgccgaaacg
ggcgagtgcgacggcctcccctgtcacgccgcaatttccctgggaccctacagcgtgctg
atcttttcccagtga

DBGET integrated database retrieval system