KEGG   Geobacter sp. M18: GM18_2980Help
Entry
GM18_2980         CDS       T01421                                 

Definition
ATP-dependent RecD/TraA family DNA helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
geb  Geobacter sp. M18
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:geb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3543964..3546192)
Genome map
AA seq 742 aa AA seqDB search
MPKRNESNPARLRGRIERVYYVGPKFSAGRLLTPTGEEVQFAGNLFARENQPVVLLGSWA
THPKYGRQFKVDGMEHDLELDPEGLIHYLANHPEIKGIGPAKARLIVESFGDAFEETLLN
DPERIALKARLPLDAVRRLRDEWLKNRSVNAVMAWLSAFGLTHHQVTTLVEKLGGNCLDI
LKEDPYILIREIRGFGFKKVDKIARKLGTPKDHTPRIRAGLNFCVREALDNGHCWIEYED
LVDQANLLLVMDALDSRVRIESALDALIEEQALSCDSHGGRFVVALPEIVRMERELAALF
GQAETPNPHFQSVKKLDALIRRCAATLNEKQLDAVRSALNHSISLISGGAGSGKSYTISV
INTICEESDLEVLLAAPTGKAAKRLEEVSGRSGTTIHRLLGYDGKGFSRSKENPIDADVL
VVDEFSMVDVPLAWHLFEAVDLSRTTVLLVGDHNQLPPVGPGNILRDLIQTRAIPTVILD
KVVRQAGVLKENCTSVLKGEVRKTSEASVGGCRDWYLVDQFTDPMAARSFLLELFQERLD
ALGFDIIKDVQVLTPTHKGPLGTKELNEELQRLIQRKLWNTEVSPVAMGRRAPFLKHDKV
IQTRNNYDLNVMNGAIGYVVDVLANGTLVIDFDGMPVELAKGSPDLQDLQLAYALTIHKT
QGSEFPCAVVVVHKAHSFMHHRNLLYTGVTRARRTAIVLGDHWGIQNCAKRCQVDDRRTF
LPLFLDAAQHADADFARVAEAE
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaagaaatgagagtaacccggcgcgactccggggaagaatagagcgcgtttac
tatgtcggacccaagttctccgcaggccgactgctcaccccgaccggtgaggaagtccag
tttgcgggcaatttgttcgcccgggaaaatcagcctgtggtcctgctcgggtcgtgggcc
acccatcccaaatacggccgtcagttcaaggtcgacgggatggagcacgacctcgaactc
gacccggaggggctgatccactatctggccaaccatccggagatcaagggcattggtccg
gccaaggccagattgatcgtcgagagtttcggcgacgcctttgaagaaacccttctgaat
gaccccgagcgcatcgcgctcaaagctcggctgcctttagatgctgtccggcggctgcgt
gacgaatggttgaagaaccgcagcgtcaacgccgtcatggcctggttgtcggcattcgga
ctgacccatcatcaggtcaccactctggtcgaaaaactcggcggcaactgcctcgatatt
ctgaaggaagacccgtacatcctcattcgggagatccggggattcggcttcaagaaggtc
gacaagatcgcccgcaagctgggcacccccaaggaccacacccctcgtatccgtgctggg
ttgaatttctgcgtccgtgaagccctggacaatggccactgctggatcgaatacgaggat
ctggtggaccaggccaatctgctactggtcatggatgccctggatagccgggttcgtatc
gagagcgccctcgacgcgctcatcgaagaacaggcgctttcctgcgattcccacggcggg
cgtttcgtggtcgctctgccggagatcgtccgcatggagcgggagctggccgcgctgttc
ggccaggccgaaacgcccaaccctcattttcagtccgtcaagaaactcgatgctctgatt
cggcgctgcgcggcgacgctgaacgagaagcagctcgacgcagtgcgctcggcactcaat
cacagcatcagcctgatctcgggtggagccggttcgggcaagagctacaccatctcggtc
atcaacaccatctgcgaggagagcgatctggaggtcttgctcgccgcgccgaccggtaag
gccgccaagcgcctggaggaagtcagcggtcgcagcggcaccaccattcaccgcctgctc
ggctatgacggcaagggtttctcgcgcagcaaggagaatcccatcgatgccgacgtcttg
gtggtcgacgagttttcgatggtcgacgtgccgctggcctggcacttgttcgaggcagtc
gacctgtcgcggaccacggtgctgctggtcggcgatcacaaccaacttccgccggtggga
cccggaaacatcctgcgcgatctgattcagacacgcgccattcccacggtcatcctcgac
aaggtcgtgcgccaggctggcgtcctcaaggagaactgcacctccgttctcaagggcgag
gtgcgcaagaccagcgaggcgtcggtgggcggatgccgggattggtatctggtggatcag
ttcaccgacccgatggcggcacgctcgttcctgctggagttgtttcaggagcggctcgat
gccctgggtttcgacatcataaaggacgtgcaggtgctgacgccgacccacaaggggccg
ctcggcaccaaggaattgaacgaggaactgcagcggctcatccagcgcaaactctggaac
accgaggtgtcgccggtcgccatgggccgtcgcgccccgtttctcaagcacgacaaggtc
atccagactcggaacaactacgacctgaacgtgatgaacggtgccatcggctatgtggtc
gatgtcctcgcaaacggcaccctggtcatcgacttcgacggcatgccggtggagctggca
aagggttcgcccgacctgcaggatctgcagctcgcctatgcgctcaccatccacaaaacc
cagggttccgaattcccctgcgccgtggtggtggtccacaaggcacattccttcatgcac
caccgcaatctgctctacacaggagtgacccgcgcccggcgcaccgccattgtcctgggt
gaccattggggcatccagaactgcgccaagcgttgccaggtggatgaccgccggaccttt
ctgcccctgtttctggacgccgcccagcacgcggatgccgatttcgcccgtgtcgcggag
gccgaatga

DBGET integrated database retrieval system