KEGG   Geobacter sp. M18: GM18_3394Help
Entry
GM18_3394         CDS       T01421                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
geb  Geobacter sp. M18
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:geb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GM18_3394
Enzymes [BR:geb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GM18_3394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3964376..3964975
Genome map
AA seq 199 aa AA seqDB search
MIALLTGKIAYKAPDHVILDVNGVGYHVFIPFSTYYALPAEGGTATLQIHTSVKEDAINL
YGFRTQQEKELFQLLIGVSGVGPKLANSILSNSEPAELAESLVSGDLARLSAIPGIGKKT
AERLVLELKEKIRKLGIAQPATSAAAAPVRQETREDVLSALINLGYKESVVQKALGELKF
PEDATVEALLKQALKVLMK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcccttctcaccggcaagatcgcctacaaggcgcccgatcacgtcatcctggac
gtgaacggcgtcggctaccatgtcttcatccccttctccacctactacgccctccccgcc
gaggggggcaccgcgacgctgcagatccacacctcggtgaaggaggacgccatcaacctg
tacggcttccgcacccagcaggaaaaggagctgttccagttgttgatcggcgtctccggg
gtcggccccaagctcgccaacagcatcctctcaaacagcgagccggcggagctggcggag
tcgctggtgagcggcgacctcgcccggctctccgccatcccggggataggcaagaaaacc
gccgagcgcctggtgctggaactgaaggagaagataaggaagctggggatcgcgcagccc
gcgaccagcgctgccgccgctccggtcaggcaggagacccgcgaggacgtcctttccgcg
ctgatcaacctgggctacaaggaatcggtcgtgcaaaaggccctgggcgagctgaaattc
cccgaagatgccacagtcgaagcactcctcaaacaggcgctaaaggtactgatgaagtag

DBGET integrated database retrieval system