KEGG   Geobacter sp. M18: GM18_3457Help
Entry
GM18_3457         CDS       T01421                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
geb  Geobacter sp. M18
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:geb00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4036970..4038451)
Genome map
AA seq 493 aa AA seqDB search
MSHLLSIDQGTTSSRATLYGTDGSALATASQPLTQHYPNPGWVEHDPEEIWEGQLACIRK
VLAAAGEGAGIAGIGITNQRETTVIWERATGRPLHRAIVWQDRRTAEFTEGLKRHGVETM
VRERTGLLLDPYFSASKLAWLLDGIDGLRARAERGEVCFGTVDSWLIFRLTGGRSHVTDL
SNASRTMLFNIRTLEWDDELLRLFNVPRAMLPEVRPSAAGFGRTAASVIGAEIPITGVAG
DQQAALFGQGCFTPGMAKATFGTGAFVVLNCGTRLGSGEGVLSTIAWQLPGEPVQYALEG
SIFIAGAAVQWLEEGLGLIGSPGEVEALAGSVADTGGVYFVPALSGLGTPYWDPYARGVI
AGLTRGSSRAHLARAALEAIAFQTADAIRAMESASGIALSELRVDGGATRNNLLLEIQAN
LLGAPVLRPRCTESTSLGAAFLAGIGAGVLDTELIGKQWALDRRFEPQLSEERRDESYRG
WRKCVQLSLGWAK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgagccacctcttatccatcgatcaggggaccaccagcagtagggcgaccctctacggc
accgacggcagcgcgcttgccacggcctcgcaaccgctcacccagcactacccgaacccg
gggtgggtcgagcacgacccggaggagatctgggaggggcagcttgcctgcatccggaag
gtcctggccgcggcaggggagggggcggggatagcgggcatcggcatcaccaaccagcgc
gagaccacggtcatctgggagcgcgccaccggcaggcccctgcaccgcgccatcgtatgg
caggaccggcgcacggccgagttcaccgagggcttgaagcgtcatggggtggagacgatg
gtgcgggagcggaccggcctcctgctcgatccctacttctccgccagcaagctcgcctgg
ctcctcgacggcatcgacgggttgcgggcgcgcgcggagcgtggggaagtctgcttcggc
accgtcgattcctggctcatcttccggctgaccggcggtaggagccacgtcaccgacctc
tccaacgcgagccggaccatgctcttcaacatcaggacccttgaatgggacgacgagctc
ttgcgccttttcaacgtcccgcgcgccatgctccccgaggtgcggccgagcgccgccggc
ttcggccggactgcggcctccgtcatcggtgccgagatccccatcaccggcgtggcgggt
gaccagcaggcggccctcttcgggcaggggtgcttcacgccgggcatggccaaggccacc
ttcggcaccggcgccttcgtggtgctgaactgcggcacccgcttggggagcggggaaggg
gtgctctcgaccatcgcctggcagcttccgggggagccggtgcagtacgccctggagggg
tcgatcttcatcgccggagccgcggtgcagtggctggaagagggactcgggctgatcgga
agccccggcgaggtcgaggcgctcgccgggagcgtggccgataccggcggggtctacttc
gtcccggcgctctccgggctggggaccccctactgggacccctatgccaggggagtcatc
gccgggcttacccgcggcagcagcagggctcacctggcgcgcgccgcgctcgaggcgatc
gctttccagacggccgacgccatccgcgccatggaaagcgcgagcgggatcgccctgagc
gagcttagggtggatggcggggcgacccgcaacaacctcctgttggagatccaggcaaac
cttctgggcgctccggtgttgcgcccccgttgcaccgagagcacctcccttggagccgcc
ttcctggcgggaatcggcgccggcgtgctggacacggaactgatcgggaagcagtgggcg
ctggaccggcgcttcgagccgcagctgtccgaggagcgccgggacgaatcgtaccgtggc
tggcgaaaatgcgtgcaactgtcgcttggatgggctaaataa

DBGET integrated database retrieval system