KEGG   Geobacter sp. M18: GM18_3482Help
Entry
GM18_3482         CDS       T01421                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
geb  Geobacter sp. M18
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:geb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4076140..4077627)
Genome map
AA seq 495 aa AA seqDB search
MVRKRKSGILLHPSSLPGPGGIGSFGEEAKHFVDFLHKSGQSLWQILPLGPTAYGNSPYS
CYSAFAGNPLLISLEALQGEGDLLPEEAKPELDSERVDYGATEIYKMARLKEAAAQFFTE
APQKRKEEFWHFCDNTFWLHDYALFMALKEQFKEVSWKDWPDALANRDPEALSSWSEKLG
TAIGEQKYMQWQFSHQWKQLKTYANVLGISIVGDLPIFVAYDSADVWANPHLFHLDEKGV
PIVVAGVPPDYFSKTGQLWGNPLYNWDNMAQQGYGWWIARLRNDLSLYDMVRIDHFRGFE
AFWEVPMWEKTAINGRWVKGPGEALFHAMRNALGNLPIIAEDLGVITAEVEALRDQFGFP
GMKVLQFAFGSGPDNPYLPHNHVRSCVVYTGTHDNDTTVGWFHSLKAKEQKNLLAYFEQD
GNDIVWQLVRCALASVADYAIIPMQDLLELPSSGRMNVPGVAGGNWSWRCPAEAFSGRLA
AKLARATELYGRLPD
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggtgagaaagagaaagagcgggatcctgttgcatcccagctcgttgccaggacctgga
ggaatcggttccttcggtgaagaagcaaagcatttcgtagatttcctgcacaaatccgga
cagtccctgtggcagatcctcccccttggccccaccgcctatggcaactcgccttactcc
tgttattcggcgttcgccggcaaccccctgctgatcagcctggaggcccttcagggcgag
ggtgacctgttgccggaagaggcgaaacctgagttggactcggagcgagtagattacggt
gccacggagatttacaagatggctcgcctcaaggaggcggctgcccagttctttaccgag
gcgccgcaaaagcgcaaggaggagttctggcatttttgcgacaacaccttctggctccac
gactatgccctcttcatggcattgaaggagcagttcaaggaagtgagttggaaggattgg
ccggacgccttggcgaaccgggatccggaggcgctttcttcctggagcgaaaaactggga
acggccataggtgagcagaaatacatgcaatggcagttttcccaccagtggaagcagctg
aagacctatgccaatgtcctggggatatcgatcgttggcgacctccccatcttcgtcgcc
tacgactccgcggatgtctgggccaatccccatctgttccacctggacgagaaaggggtg
cccatcgtcgtcgccggcgtccctcccgattatttcagcaagaccgggcaactctggggc
aaccctctttacaactgggacaatatggcccagcaagggtatggctggtggatcgcccgg
ttgcgcaacgacctctccctctacgacatggtgcgcatcgatcacttccgcggcttcgag
gctttctgggaagtgccgatgtgggagaagaccgccatcaacggccggtgggtgaagggg
ccgggagaggcgctcttccatgccatgcgtaacgccctgggtaacctccccatcatcgca
gaggatttgggcgtcatcaccgcggaggtcgaggcgctcagggaccagttcggcttcccc
gggatgaaggtactccagtttgccttcggctccggaccggataacccgtacctgccgcac
aaccacgtcaggtcctgcgtcgtttacaccgggacccacgacaacgacacgaccgtcggc
tggttccactccctgaaggcgaaggaacagaagaacctgctcgcctatttcgagcaagac
ggaaacgatatcgtttggcagttggttaggtgcgcactggcttcagttgcagactatgcc
atcatcccgatgcaggatctcctggagttgcccagtagcgggaggatgaacgtgccgggc
gtggctggggggaactggagctggagatgcccggcggaggccttctccggaaggctggcc
gcgaaactcgcacgggctaccgagctttacggccggctgccggattga

DBGET integrated database retrieval system