KEGG   Geobacter sp. M18: GM18_3501Help
Entry
GM18_3501         CDS       T01421                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
geb  Geobacter sp. M18
Brite
Enzymes [BR:geb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     GM18_3501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4096971..4097636)
Genome map
AA seq 221 aa AA seqDB search
MSIDPKRELLARKERMLSEHLVARGIRDEAVLKAMREVPRESFLPPGMELFAYEDGPLPI
QEGQTISQPYIVAYMIEALELKGEEKVLEIGTGSGYAAAVLSLCAAEVFTVERIASLARQ
ADERLRELGYRNVTVHLGDGTLGWQEHAPYDGIVVTAGAPKVPEELERQLAPGGRLVIPV
GPTPHLQDLIRVRRLKSGELRRENLCAVRFVPLIGEKGWEY
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgatccgaaaagggaactgttggcgaggaaggagcggatgctgagcgagcac
ctcgtggcacgcggcatccgggacgaggcggtcctgaaggcgatgcgcgaggtgccgcgc
gagtcgttcctgccgccgggcatggagcttttcgcctacgaggacggtccgttgccgatc
caggaggggcagaccatctcccagccgtacatcgtggcctacatgatcgaggcgctggag
ctgaagggagaggaaaaggtcctggagatcggcaccggctccggctatgcggctgcggta
ctgagcctgtgcgccgccgaggtctttaccgtcgagcggattgcgtccctggcgcgccag
gcggacgaacggctgcgcgagcttggctaccgtaacgtgacggtccatctgggcgacggc
accctggggtggcaggagcatgcaccgtatgacggcatcgtggtgaccgcgggagcaccc
aaagtgccggaggaactcgaacggcaactggcgcccggcgggaggctggtcatcccggtc
gggccgacgccgcacctgcaggacctgatcagggtgcggcgtctgaagagcggcgaactg
cggcgggagaacctctgcgcggtccgcttcgtgcccctcatcggcgaaaaggggtgggag
tactag

DBGET integrated database retrieval system