KEGG   Geobacter sp. M18: GM18_3646Help
Entry
GM18_3646         CDS       T01421                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
geb  Geobacter sp. M18
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GM18_3646
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GM18_3646
  Amino acid metabolism
   00310 Lysine degradation
    GM18_3646
Enzymes [BR:geb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GM18_3646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4267819..4269114)
Genome map
AA seq 431 aa AA seqDB search
MDIKVPAVGESVYEAVIARWLKKTGDVVAKDEPLCEVETDKVTLEVISEADGVLSIIAGE
GETVKIGAVIGTIDARGPEAEAPKAGMETAAAKPAAKTQEKSAEKPGPAPPMSPSGRKLA
RELGVEPGTVQGSGRGGRATNEDVLKAQAAQTERAAGTEPATEAGAAPVRPEAPGEPAEP
AAAPAAGPKPPPRAPEEAGERIVRKPMSQIRKRIAERLVSVRQNTAMLTTFNEADMSEVL
QLRKKHGEHFQKRHNVKLGFMSLFVRACCAALQEFPEVNASIEGDDIVYHNFCDIGVAVG
SERGLVVPVLRGAENMTLAQIELAIGEFAEKVRNNRIALSDLEGGTFTISNGGIYGSMLS
TPILNPPQSGVLGMHNIQERAVVIDGQIVIRPMMYLALSYDHRIVDGKGAVGFLKRVKEY
IEDPEELLLEC
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaaggtgccggcggttggagagtcagtctatgaggcggttatcgccaggtgg
ctcaagaagacgggcgacgtcgtggccaaggacgagccgctttgcgaggtcgagacggac
aaggtaaccctggaggtgatctcggaggccgacggcgtgctcagcatcatcgccggcgag
ggggaaacggtgaagatcggcgccgtgatcggcaccatcgacgcgcgtggcccggaggcg
gaggcgcccaaggcgggcatggaaaccgctgccgccaagcctgcggccaaaacccaggag
aagagcgctgagaagccgggcccggctcctcccatgtcgccgtcgggacgcaaactggcg
cgcgagctgggtgtggaacccgggacggtgcagggaagcggccgcggcggccgcgccacc
aatgaagacgtcttgaaggcacaggcggcacaaaccgaacgggccgcggggacggagccc
gccacagaagccggggcggcaccggtccgtccggaggcgccgggtgagcccgctgaacct
gccgcagcgccggcggcggggccgaaacctcccccccgggctcctgaagaggcgggggag
cgcatcgtgcgcaagccgatgtcgcagatcaggaagcgcatcgccgagcgcctggtctcg
gtgcggcagaacacggccatgctcaccaccttcaacgaggcggacatgagcgaggtactc
cagctgcgcaagaaacacggagagcacttccaaaagcgccacaacgtgaagctcggcttc
atgtcgctcttcgtacgcgcctgctgcgccgctttgcaggaattccccgaggtcaatgcg
agcatcgagggagacgacatcgtctaccacaacttctgcgacatcggggtcgcggtcggg
agcgagcgcggactggtggtgccggtgctgaggggagccgagaacatgaccctcgcccag
atcgagctcgccatcggggagttcgccgagaaggtgcgcaacaaccggatcgccctttcc
gacctggagggtgggaccttcaccatttccaacggcggcatctacggctcgatgctctcg
acccccatcctgaacccgccgcagtccggcgtgctcggcatgcacaacatccaggagcgc
gccgtggtaatcgatgggcagatcgtgatccgccccatgatgtacctggcgctttcctac
gaccacaggatcgttgacggcaagggagcggtcggtttcctgaagcgggtcaaggaatac
atcgaggacccggaggagctgcttttggagtgctga

DBGET integrated database retrieval system