KEGG   Geobacter sp. M18: GM18_3646Help
Entry
GM18_3646         CDS       T01421                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
geb  Geobacter sp. M18
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GM18_3646
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GM18_3646
  Amino acid metabolism
   00310 Lysine degradation
    GM18_3646
Enzymes [BR:geb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GM18_3646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4267819..4269114)
Genome map
AA seq 431 aa AA seqDB search
MDIKVPAVGESVYEAVIARWLKKTGDVVAKDEPLCEVETDKVTLEVISEADGVLSIIAGE
GETVKIGAVIGTIDARGPEAEAPKAGMETAAAKPAAKTQEKSAEKPGPAPPMSPSGRKLA
RELGVEPGTVQGSGRGGRATNEDVLKAQAAQTERAAGTEPATEAGAAPVRPEAPGEPAEP
AAAPAAGPKPPPRAPEEAGERIVRKPMSQIRKRIAERLVSVRQNTAMLTTFNEADMSEVL
QLRKKHGEHFQKRHNVKLGFMSLFVRACCAALQEFPEVNASIEGDDIVYHNFCDIGVAVG
SERGLVVPVLRGAENMTLAQIELAIGEFAEKVRNNRIALSDLEGGTFTISNGGIYGSMLS
TPILNPPQSGVLGMHNIQERAVVIDGQIVIRPMMYLALSYDHRIVDGKGAVGFLKRVKEY
IEDPEELLLEC
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaaggtgccggcggttggagagtcagtctatgaggcggttatcgccaggtgg
ctcaagaagacgggcgacgtcgtggccaaggacgagccgctttgcgaggtcgagacggac
aaggtaaccctggaggtgatctcggaggccgacggcgtgctcagcatcatcgccggcgag
ggggaaacggtgaagatcggcgccgtgatcggcaccatcgacgcgcgtggcccggaggcg
gaggcgcccaaggcgggcatggaaaccgctgccgccaagcctgcggccaaaacccaggag
aagagcgctgagaagccgggcccggctcctcccatgtcgccgtcgggacgcaaactggcg
cgcgagctgggtgtggaacccgggacggtgcagggaagcggccgcggcggccgcgccacc
aatgaagacgtcttgaaggcacaggcggcacaaaccgaacgggccgcggggacggagccc
gccacagaagccggggcggcaccggtccgtccggaggcgccgggtgagcccgctgaacct
gccgcagcgccggcggcggggccgaaacctcccccccgggctcctgaagaggcgggggag
cgcatcgtgcgcaagccgatgtcgcagatcaggaagcgcatcgccgagcgcctggtctcg
gtgcggcagaacacggccatgctcaccaccttcaacgaggcggacatgagcgaggtactc
cagctgcgcaagaaacacggagagcacttccaaaagcgccacaacgtgaagctcggcttc
atgtcgctcttcgtacgcgcctgctgcgccgctttgcaggaattccccgaggtcaatgcg
agcatcgagggagacgacatcgtctaccacaacttctgcgacatcggggtcgcggtcggg
agcgagcgcggactggtggtgccggtgctgaggggagccgagaacatgaccctcgcccag
atcgagctcgccatcggggagttcgccgagaaggtgcgcaacaaccggatcgccctttcc
gacctggagggtgggaccttcaccatttccaacggcggcatctacggctcgatgctctcg
acccccatcctgaacccgccgcagtccggcgtgctcggcatgcacaacatccaggagcgc
gccgtggtaatcgatgggcagatcgtgatccgccccatgatgtacctggcgctttcctac
gaccacaggatcgttgacggcaagggagcggtcggtttcctgaagcgggtcaaggaatac
atcgaggacccggaggagctgcttttggagtgctga

DBGET integrated database retrieval system