KEGG   Geobacter sp. M18: GM18_3646Help
Entry
GM18_3646         CDS       T01421                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
geb  Geobacter sp. M18
Pathway
geb00020  Citrate cycle (TCA cycle)
geb00310  Lysine degradation
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01120  Microbial metabolism in diverse environments
geb01130  Biosynthesis of antibiotics
geb01200  Carbon metabolism
Module
geb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
geb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GM18_3646
  Amino acid metabolism
   00310 Lysine degradation
    GM18_3646
Enzymes [BR:geb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GM18_3646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ADW15074
JGI: GM18_3646
UniProt: E8WP91
Position
complement(4267819..4269114)
Genome map
AA seq 431 aa AA seqDB search
MDIKVPAVGESVYEAVIARWLKKTGDVVAKDEPLCEVETDKVTLEVISEADGVLSIIAGE
GETVKIGAVIGTIDARGPEAEAPKAGMETAAAKPAAKTQEKSAEKPGPAPPMSPSGRKLA
RELGVEPGTVQGSGRGGRATNEDVLKAQAAQTERAAGTEPATEAGAAPVRPEAPGEPAEP
AAAPAAGPKPPPRAPEEAGERIVRKPMSQIRKRIAERLVSVRQNTAMLTTFNEADMSEVL
QLRKKHGEHFQKRHNVKLGFMSLFVRACCAALQEFPEVNASIEGDDIVYHNFCDIGVAVG
SERGLVVPVLRGAENMTLAQIELAIGEFAEKVRNNRIALSDLEGGTFTISNGGIYGSMLS
TPILNPPQSGVLGMHNIQERAVVIDGQIVIRPMMYLALSYDHRIVDGKGAVGFLKRVKEY
IEDPEELLLEC
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaaggtgccggcggttggagagtcagtctatgaggcggttatcgccaggtgg
ctcaagaagacgggcgacgtcgtggccaaggacgagccgctttgcgaggtcgagacggac
aaggtaaccctggaggtgatctcggaggccgacggcgtgctcagcatcatcgccggcgag
ggggaaacggtgaagatcggcgccgtgatcggcaccatcgacgcgcgtggcccggaggcg
gaggcgcccaaggcgggcatggaaaccgctgccgccaagcctgcggccaaaacccaggag
aagagcgctgagaagccgggcccggctcctcccatgtcgccgtcgggacgcaaactggcg
cgcgagctgggtgtggaacccgggacggtgcagggaagcggccgcggcggccgcgccacc
aatgaagacgtcttgaaggcacaggcggcacaaaccgaacgggccgcggggacggagccc
gccacagaagccggggcggcaccggtccgtccggaggcgccgggtgagcccgctgaacct
gccgcagcgccggcggcggggccgaaacctcccccccgggctcctgaagaggcgggggag
cgcatcgtgcgcaagccgatgtcgcagatcaggaagcgcatcgccgagcgcctggtctcg
gtgcggcagaacacggccatgctcaccaccttcaacgaggcggacatgagcgaggtactc
cagctgcgcaagaaacacggagagcacttccaaaagcgccacaacgtgaagctcggcttc
atgtcgctcttcgtacgcgcctgctgcgccgctttgcaggaattccccgaggtcaatgcg
agcatcgagggagacgacatcgtctaccacaacttctgcgacatcggggtcgcggtcggg
agcgagcgcggactggtggtgccggtgctgaggggagccgagaacatgaccctcgcccag
atcgagctcgccatcggggagttcgccgagaaggtgcgcaacaaccggatcgccctttcc
gacctggagggtgggaccttcaccatttccaacggcggcatctacggctcgatgctctcg
acccccatcctgaacccgccgcagtccggcgtgctcggcatgcacaacatccaggagcgc
gccgtggtaatcgatgggcagatcgtgatccgccccatgatgtacctggcgctttcctac
gaccacaggatcgttgacggcaagggagcggtcggtttcctgaagcgggtcaaggaatac
atcgaggacccggaggagctgcttttggagtgctga

DBGET integrated database retrieval system