KEGG   Geobacter sp. M18: GM18_3745Help
Entry
GM18_3745         CDS       T01421                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
geb  Geobacter sp. M18
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GM18_3745
Enzymes [BR:geb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     GM18_3745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4382769..4383257)
Genome map
AA seq 162 aa AA seqDB search
MEQCAYIGLGSNIGDRELKLLMAVAELGKLPQTRVTAVSPFYETDPVGGVPQDNFYNAVV
RLNTELAPLELLERLKRLEAEVFHRTPSERWGARSMDLDILLYGELVFTCDRLTIPHPRL
AERRFALQPLADIAPDLIHPTSGKRIIELLTELTSTEKVVRI
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtggaacagtgcgcgtacatagggcttgggagcaacatcggcgaccgggagctgaagctc
ctgatggcggtcgccgagctgggcaagctgccgcagaccagggtcaccgccgtctcccct
ttctacgagaccgacccggtgggaggggtgccccaggacaacttctataacgcggtggtg
cgcctcaacaccgagctggcgccgctggagcttctggaacggctgaaaaggctggaggcc
gaagttttccaccggacgccgtcggagcgctggggcgcccgcagcatggacctcgacatc
ctcctctacggtgaactggtctttacctgcgaccggctcaccatcccgcatccgcgcctg
gccgagcgccgtttcgccctccagccgctggccgacatcgcccccgacctgatacacccg
acctcgggcaagcgcatcatcgaactgttgacggaactgacctccaccgagaaggtggtc
aggatatag

DBGET integrated database retrieval system