KEGG   Geobacter sp. M18: GM18_3812Help
Entry
GM18_3812         CDS       T01421                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
geb  Geobacter sp. M18
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GM18_3812
Enzymes [BR:geb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     GM18_3812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4457328..4458311
Genome map
AA seq 327 aa AA seqDB search
MNSKEIPMVPNRKASLPRVYGDTPSFLGVPVLDARNLAAGCDVIVAGVPWEGTVTWGSFS
SCELAPRSIRHASARYGGFLPEYEIDLFDHLKLGDMGDVMVNPNDPAETMQNVHRAMLRI
YRSRSIPFILGGDHSFTPEIIRALGDAGEGEIGVIHFDAHLDNNKSFGADMYPRCGPLHR
ISQLPGVRKESIVHMGIRGPRNSPAQYDYARSMGARIFTTKEIHERGMPEVTEEAIAIAR
EKTRHVFVTICSDCIDAGYNPGGPADFNGLLPNELLPALQRIGASGIDGLDYVEVYPGQD
PQGYSSHLAAWAMIYALVGLAQRKRDL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaaagagatcccgatggtccccaacagaaaggcctcactccccagggtgtac
ggggacaccccctcgttcctgggcgtcccggtcctcgatgcccgcaacctggctgccggc
tgcgacgtcatcgtggcaggggtaccctgggagggaaccgtgacctggggttccttcagc
agttgcgaactggcaccgcgcagcatcaggcacgcctcggcgcgctacggcgggttcctc
ccggaatacgagatcgacctcttcgaccatctgaaactcggggacatgggtgacgtcatg
gtgaaccccaacgacccggcggagaccatgcagaacgtgcaccgcgccatgctccggatc
taccggagccggagcatccccttcatcctcgggggagaccactccttcaccccggagatc
atcagggctctgggggacgcgggcgagggggagatcggcgtgatccatttcgacgcccac
ctggacaacaacaagtccttcggtgccgacatgtacccgcgttgcggccctttgcaccgg
atctcgcagcttcccggggtgcgcaaggaaagcatcgtgcacatggggatccgggggccg
aggaactcccccgcgcagtacgactacgcccgcagtatgggggcgcgcatcttcaccacg
aaggagatccacgagcgggggatgccggaggtcaccgaggaggcgatcgccatcgcccgt
gagaaaaccaggcacgtgttcgtgaccatctgcagcgactgcatcgacgccggctacaac
cccggaggacctgccgacttcaacggcctgcttcccaacgagctcctaccggcgctgcag
aggatcggcgcctccggcatcgacggcctggactacgtcgaggtgtacccgggacaggac
ccgcaggggtactcttcccatctggccgcctgggccatgatctacgccctggtcggcctg
gcccagcgcaagcgggacctttga

DBGET integrated database retrieval system