KEGG   Geobacter sp. M18: GM18_3970Help
Entry
GM18_3970         CDS       T01421                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
geb  Geobacter sp. M18
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GM18_3970
Enzymes [BR:geb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     GM18_3970
Exosome [BR:geb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GM18_3970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4653324..4654343)
Genome map
AA seq 339 aa AA seqDB search
MFYPVYRARRIRGKEVFRNMVRETSISANDLIYPMFSAFGKGIKKEISSMPGIYQQSIEN
IVEEAQEAYELGVPAVILFGIPEQKDAMGSDAYSETGIIQETIRAIKKSVPKLAVITDVC
MCEYTDHGHCGVIKNGDVDNDETLELLAREALSHAQAGADMVAPSDMMDGRVAAIRESLD
NNGFNQIPLMSYAVKYASGYYGPFREAAESTPQFGDRRSYQMDPGNRLEAIREARMDVEE
GADILMVKPGLPYLDIVREVRNEFNLPTAVYNVSGEYSMVKAAAKMGWIDEDRVIMETMM
SFKRAGADLILTYHSKEVAKLLRKGYEAELNGRCGCGCR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttctacccggtgtacagagcgagacgaattcggggcaaggaagtcttcagaaacatg
gtcagggagacctccatctccgccaacgacctgatatacccgatgttttcggccttcggc
aagggaatcaagaaagagatctcctccatgccgggcatctaccagcagtccatcgagaac
atcgttgaagaagcccaggaagcctacgagctgggtgtcccggccgttatcctcttcggc
atcccggagcagaaggacgccatgggtagcgacgcctactccgagaccggcatcatccag
gagaccatccgcgccatcaagaagagcgtgcccaagctggccgtcatcaccgatgtatgc
atgtgcgagtacaccgaccacggccactgcggcgtgatcaaaaacggcgacgtcgacaac
gacgagaccctggagcttctggcccgcgaggcgctctcccacgcccaggcaggcgccgac
atggtcgccccctccgacatgatggacggccgcgtggcagccatccgcgagtcgctggac
aacaacggcttcaaccagatcccgctgatgagctacgccgtgaagtacgcctccggctac
tacgggccgttccgcgaggcagccgagtccaccccgcagttcggtgaccgccggtcctac
cagatggatccgggcaaccggctggaggctatccgcgaggcacgcatggacgtcgaggaa
ggcgccgacatactgatggtcaagccgggcctgccgtatctcgacatcgtgcgcgaggtg
agaaacgagttcaacctcccgaccgccgtgtacaacgtctccggcgagtacagcatggtg
aaggccgccgccaagatggggtggatcgacgaggaccgcgtgataatggagaccatgatg
tccttcaagcgggccggtgccgacctgatcctgacctaccactccaaggaagtcgcgaag
ctgctgcgcaaggggtatgaggcggaactgaacggccgttgcggctgcggctgcaggtaa

DBGET integrated database retrieval system