KEGG   Geobacter sp. M18: GM18_4153Help
Entry
GM18_4153         CDS       T01421                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
geb  Geobacter sp. M18
Pathway
geb00340  Histidine metabolism
geb01100  Metabolic pathways
geb01110  Biosynthesis of secondary metabolites
geb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:geb00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    GM18_4153
Enzymes [BR:geb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     GM18_4153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADW15568
JGI: GM18_4153
UniProt: E8WV29
Position
complement(4879965..4881254)
Genome map
AA seq 429 aa AA seqDB search
MQFLDIREAGFQAKFDAIVERGEESGREVEEVVLGIISDVRRRGDDALLDYTKRFDRLEC
DAAGLEITEEEFAKAFAQVDEKDLAALKLAVERVGRYHEKQKQQSWLSTEESDIMLGQKV
TPLAKVGIYVPGGKACYPSSVIMNAVPAKVAGVGEIIMVVPAPGGETNPHVLAAAKLSGV
DRVFRIGGAQAVAALAYGTATVPKVDKITGPGNIYVATAKKLVFGQVGIDMIAGPSEILV
INDGSGNPAHIAADLLSQAEHDELASSVLITTDRSFGEKVAAEVERQLKELSREAIARKS
WESFGVIIVAGNLEEAIAFSNRIAPEHLELAVEHPFEIMPLITNAGAIFMGHYTPEASGD
YLAGPNHTLPTGGTARFFSPLSVDDFVKKSSIIYFTKGGLQRVGEDIVRISRLEGLDAHG
RSVSFRLDS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcctcgacattagggaagcaggttttcaggcgaagtttgacgccatcgtggag
cgcggcgaggagtcggggcgcgaggtcgaagaggtggtgctgggcatcatctccgacgtg
cgcaggcgcggcgatgatgcgctcctcgactacacgaagcgctttgaccggctggagtgc
gacgccgccggcctggagatcaccgaggaggagttcgccaaggcctttgcccaggtggac
gaaaaggacctcgcggccctgaagctcgctgtcgagcgggtaggtcgctaccatgagaag
cagaagcagcagagctggctctccaccgaggagagcgacatcatgctgggccagaaggtg
accccgcttgccaaggtcggcatctacgtccccggcggcaaggcctgctacccctccagc
gttatcatgaacgcagttccggccaaggttgccggcgtcggcgagatcatcatggtcgtt
cccgccccgggcggcgagaccaatccccacgtgctggcggccgccaagctctccggcgtc
gaccgcgtcttccgcatcggcggcgcgcaggcagtcgcggcccttgcctacggcaccgcc
accgtcccgaaagtcgacaagatcaccggtccgggcaatatctacgtggccaccgccaag
aaactggttttcggtcaggtcggcatcgacatgatcgcagggcccagcgagatcctagtc
atcaacgacggcagcggtaacccggctcacatcgcagcggacctcctttcccaggcggag
cacgacgagcttgcctcgtcggtgctgatcaccaccgaccgctccttcggcgagaaggtg
gccgccgaggtggagcgccagttgaaggaactctcccgcgaggccatcgcccgcaagtcc
tgggagtccttcggcgtcatcatcgtggccggcaacctggaggaggccatcgccttctcc
aaccggatcgcgccggagcacctggaactcgccgtggagcatcccttcgagatcatgccg
ctgatcaccaacgcgggcgccatcttcatggggcactacacccccgaggcctccggcgac
tacctggcaggtcctaaccacacgctccccactggcggcacggcccgtttcttctcgccc
ctctccgtcgacgatttcgtgaagaagagctccatcatctacttcaccaagggggggctg
cagcgggtcggcgaggacatcgtcaggatcagcaggctggaggggctcgacgcccacggc
aggtcggtcagcttcaggctcgacagctag

DBGET integrated database retrieval system