KEGG   Geitlerinema sp. PCC 7407: GEI7407_0064Help
Entry
GEI7407_0064      CDS       T02366                                 

Definition
uroporphyrinogen-III C-methyltransferase, uroporphyrinogen-III synthase (EC:4.2.1.75 2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GEI7407_0064
Enzymes [BR:gei01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     GEI7407_0064
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GEI7407_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(63950..65467)
Genome map
AA seq 505 aa AA seqDB search
MTTQGFVYLVGAGPGDRAYLTVRGLQILGLAEVLIYDALADPRLLDPVPETCLRLEVGKR
GGEASTPQADINALLVKHCREGRRVVRLKSGDPFIFGRSSAEIQALVAAQCPFEVVPGVS
SALAAPLLDGIPLTDPAMSQCFAVCTAHEPDRLNWAALAELDTVVFLMGGRSLAEIVHQL
VRHGRSPRTPIAIIRWAGRPQQHTWVGTLGDIVEKTQGEKLSPTVIVVGEVVQLREFLRS
PISVPQPLSNQTILVTRAAGQSSAFTQQLQAVGASVIEMPALEIRPPSSWAPLDQAIAHL
RDFDWLILTSSNGVDYFFDRMVSLGRDVRQLTGIKLAVVGKKTAASLQQRGLVPDFVPPD
FVADSMVEHFPEPPKGQRILFPRVESGGREVLVQSLGAAGAEVVEVAAYESGCPQTVDAA
ALHALQNGEIDVVTFASSKTVKHFCQLLEQAVGESWPTLVQSVAIASIGPQTSRACESAL
GRVDIEAQEYTLEGLTAAIAAWAAP
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccagggatttgtctacttggtcggggcgggtcccggcgatcgcgcgtatctg
acggtgcgggggctccagatcctggggctggcggaggtgctgatctacgatgccctggcc
gatccgcgcctgctcgatccggtgccggagacctgtttgcgcctagaggtgggcaagcgc
ggcggggaagcgagtacgccccaggccgacattaatgcgctcttggtgaagcactgccgc
gagggccgccgggtggtccggctcaagagcggcgatccgtttatttttggccgatcgagc
gccgaaattcaggccctggtggcagcccagtgtccctttgaggtggtgccgggggtctcg
tcggcgctggccgcgcccctgctagacggcattccgctgacggacccggccatgagccag
tgctttgcggtgtgtacggcccacgagcccgatcgcctaaactgggcggccctggcggag
ctggacacggtggtgtttctgatgggcgggcgatcgctggccgaaatcgtccaccagctg
gtgcgccacgggcgatcgccccggacccccatcgccattattcgctgggcgggccggccc
cagcagcacacctgggtgggcaccctgggggacatcgtggagaaaacccagggcgagaag
ctttcgcccaccgtgatcgtggtgggggaggtggtacagttgcgggagtttctgcgatcg
ccgatttccgtgcctcagcccctttccaaccaaaccattcttgtcacgcgcgcagcgggc
cagtccagcgcctttacccagcagctccaggccgtgggggcctcggtgatcgagatgccc
gccctggaaattcgcccgccttcgagctgggcacccctggaccaggcgatcgcccatttg
cgcgactttgactggctgattttgacttctagcaacggcgtagattatttctttgatcgc
atggtgagcctgggccgggacgtgcgccagctcaccgggatcaagctggccgtcgtgggc
aaaaaaaccgccgccagtctccagcagcgggggctagtgccggactttgtgccgccggac
tttgtggctgattcgatggtggagcacttcccagagccgccgaaggggcagcgcatcctg
ttcccgcgagtggagagcgggggccgggaggtgctcgtgcagtccctgggcgcggcgggg
gccgaggtggtggaggtggcggcctacgagtcgggctgcccgcaaactgtggacgccgct
gcgctgcacgccttgcagaatggcgaaatcgacgttgtcaccttcgctagctccaagacc
gtgaagcatttttgtcagctgctcgagcaggcggtgggggaaagctggccgacgctggtg
cagtcagtggcgatcgcctccattggtccccagacgtcgcgggcctgcgagagcgccctg
ggccgggtggacatcgaggcccaggagtacaccctggaggggctgacggcggcgatcgcg
gcctgggcggccccgtga

DBGET integrated database retrieval system