KEGG   Geitlerinema sp. PCC 7407: GEI7407_0159Help
Entry
GEI7407_0159      CDS       T02366                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    GEI7407_0159
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GEI7407_0159
Enzymes [BR:gei01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     GEI7407_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(183037..185502)
Genome map
AA seq 821 aa AA seqDB search
MEFSSAAVSSAAWQRPLGLGWERPYTVRYASNLDDGPWHGMPLGGFGAGCLGRSPRGDFN
LWHIDGGEHVFQSMPACQFSVFEQGADGTSQAYALCSEAPAESLGQWQWYPASMAERSTG
TYSALYPRSRFDYEGVFRARLACEQFSPIWADNYQESSYPVAVFEWTAHNPTDQLLTLSI
LLTWQNMVGWFTNALKSPEVKVRDDGSPVYEYQPRLGESEGNFNQWIAEGAWVGCLMDRA
GRAEEPQEGEGQWAIATQCEGPGTEIFYHTRWNPAGDGGELWRTFAQTGALENRIDGTPA
QGEEQIGGAIALRFTLAPGETRRVPFVLAWDFPVTEFAAGTAAYRRYTDFFGRSGRNGWA
IARTALEEYSAWQARIAAWQQPILDRADLPNWFKMALFNELYDLTSGGTLWSAASDRDPV
GQFAVLECIDYRWYESLDVRLYGSFGLLMLWPELEKSVMRAFARAIPTADDRQRVIGYYY
TQGTESPLALRKALDATPHDLGAPNEHPWEKTNYTSYQDCNLWKDLGSDFVLQVYRDFRL
TGSTDDAFIAECWPAVTRALAYLKAFDQDGDGIPENSGAPDQTFDDWRLQGVSAYCGGLW
IAALEAAIALGERLQQHPVSDHPELSQGAIAHHLSTYRTWLAQSRAVYDDALWNGRYYRL
DSGSGSEVVMADQLCGQFYARLLDLPDVVASDRALSALKTVYDSCFLRFHDGKFGAANGV
KPDGSPENPKATHPLEVWTGINFGIAAFLVQMGLRDEGFRLTQAVVEQIYEHGLQFRTPE
AITAVGTFRACHYLRPMAIWAVYGVLTGFQSAAPGSAPEPK
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcatccgctgctgtttcgtctgctgcttggcaacgcccgctgggtttgggg
tgggagcgaccttatacggtgcgctacgccagtaatttggacgatgggccgtggcacggc
atgcccttgggaggctttggggcggggtgtctggggcgatcgccccggggcgacttcaat
ctgtggcacatcgacggcggcgagcatgtatttcagtcgatgccagcctgccagttcagc
gtctttgagcaaggggcagacggcacctcccaggcttacgccctgtgcagtgaggcccca
gcggagagcctcggtcagtggcagtggtacccggcctccatggcggagcgctccaccggc
acctattcggccctgtacccccgcagccgcttcgactatgagggggtgtttcgcgctcgt
ctggcctgtgagcagttttcgccgatctgggccgacaactatcaagagagcagctatccg
gtggcggtgtttgagtggacggcccacaacccgacggatcagctgctgacgctgagcatt
ttgctgacgtggcagaacatggtgggctggtttaccaatgcgctgaagtcgccggaggtg
aaggtccgcgacgacggcagcccggtctacgagtaccagccgcgcctgggagagagcgag
ggcaactttaatcagtggatcgcggaaggggcctgggtcggctgcttgatggatcgggcg
ggccgcgcggaggaaccccaggaaggagagggtcagtgggcgatcgccacccagtgcgag
gggccagggacggagattttttatcacacgcgctggaacccggctggagacgggggagag
ctgtggcgcacctttgcccagacgggggctctggagaaccggattgacgggacgccggcc
caaggcgaagagcagatcggcggggcgatcgccctgcgcttcactttggcgccgggtgaa
acgcggcgggtgccctttgtcctagcctgggacttcccagtgacggagtttgcggcaggg
acggcggcctatcgccgctacaccgacttttttggccgcagcggtcgcaacgggtgggcg
atcgcccgcaccgccctcgaagagtattcggcgtggcaggcccgcattgccgcttggcag
cagccgattttggaccgagcggacctgccgaactggttcaagatggcgctatttaatgag
ctgtacgacctgaccagcggcggcacgctgtggagcgctgctagcgatcgcgatccggtg
ggccagtttgccgttctcgagtgcatcgactaccgttggtacgagagcctggacgtgcgg
ctctacggctcctttggcctgctaatgctgtggccagagctggagaagtcggtgatgcgc
gcctttgcccgcgccattcccaccgccgacgatcgccagcgcgtgattggctactactac
actcaggggaccgagagccccctggccctgcgcaaggccctcgacgccacgccccacgac
ctcggcgcgcccaacgagcacccctgggagaagaccaactacaccagctaccaggactgc
aacctgtggaaggatctgggcagcgattttgtcttgcaggtgtaccgagatttccggctg
acagggtcgacggacgacgccttcatcgctgagtgctggcccgccgtgacgcgcgccctg
gcctacctcaaggcctttgaccaagacggggacggcattcccgagaactccggcgcgcct
gaccagacctttgatgactggcgcttgcagggggtgagcgcctactgcggcggcctgtgg
attgcggccctggaggcggcgatcgccctgggagagcgacttcagcagcacccggttagc
gatcatcctgagctgagccaaggggcgatcgcccatcacctgagcacctatcgcacctgg
ctggcccagtcccgcgccgtctacgacgacgccctctggaacgggcgctattaccgcctc
gacagcggcagcggctccgaagtggtcatggcggaccagctctgcggccagttctacgcc
cgcctgctggacttgccggatgtggtggcgagcgatcgcgccctgtctgccctgaagacc
gtttatgattcgtgcttcttacgcttccacgacgggaaatttggggcggccaacggcgtc
aagcccgacggctctcccgagaaccccaaggccacccacccgctggaggtctggaccggc
atcaacttcggcattgcggcgtttctggtgcagatgggtctgcgggacgaaggcttccgg
ctgacccaggccgtcgtggagcagatctacgagcacggcctccagttccgcacccccgag
gcgatcaccgccgtggggactttccgggcctgccactacctgcgaccgatggccatttgg
gcggtctacggcgtgctcacggggttccagagcgcggccccaggctccgcacctgagccc
aaataa

DBGET integrated database retrieval system