KEGG   Geitlerinema sp. PCC 7407: GEI7407_0429Help
Entry
GEI7407_0429      CDS       T02366                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00020  Citrate cycle (TCA cycle)
gei00640  Propanoate metabolism
gei00660  C5-Branched dibasic acid metabolism
gei01100  Metabolic pathways
gei01110  Biosynthesis of secondary metabolites
gei01120  Microbial metabolism in diverse environments
gei01130  Biosynthesis of antibiotics
gei01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GEI7407_0429
   00640 Propanoate metabolism
    GEI7407_0429
   00660 C5-Branched dibasic acid metabolism
    GEI7407_0429
Enzymes [BR:gei01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GEI7407_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: AFY64930
UniProt: K9S444
Position
512881..514041
Genome map
AA seq 386 aa AA seqDB search
MDLLEYQAKELFHQKGIPVLPSQRIEQPKDLKGLKIPYPVVLKSQVRTGGRGKAGGVKFV
ENTIDAIAAAQTIFHLPIKGEYPKVLLAESKYDAAREFYLAVVLDSTVRRPVLLGSQQGG
VGIESTMDHVQHVVVDDGFSSFYARRLAIQMGLQGALIGAVSTIIEKMYRLFIEKDLDLV
EINPLGVSASDDVMALDGKVTVNDYALDRHPDISALVANIPGQNQKDRGLLEPLQHLDLV
GLEGNIGILCNGTGLTLATMDLVSQAGGKPANLLNVGRETNFEPPAQSLCGRIAQGLEQV
ARHKGVKVVLVNILGNVTDCEAVSSLIAEWWQRSHQSPRSRSVPQVIVRLVGDRLEAARE
TLSVIEIPMVEDLEDAVSQAVKLAKA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggacttgctagagtatcaggccaaggaactgttccaccaaaagggcattcccgttcta
ccctcccagcgcattgagcaacccaaagacctcaaaggcctgaaaattccctatcccgta
gtgctcaagtcccaagtgcggaccggaggccggggcaaagcgggcggggtaaagtttgtc
gaaaacaccatcgacgcgatcgccgctgcccagaccatttttcatttgccgatcaaaggc
gagtaccccaaagtcctcctagccgagtcgaagtacgacgcagcgcgggagttttatctg
gcggtcgtgctagacagcaccgtacgtcgcccggtgcttctcggctcccagcaaggcggc
gtcgggatcgagtccacgatggatcatgtgcagcatgtggtggtagatgacggcttctcg
tctttctatgcgcggcggctcgccatccagatgggcctccagggcgcgctgattggggcg
gtgagcaccatcatcgagaagatgtaccgcctctttatcgagaaagacctggatctcgta
gagatcaaccccctgggcgtcagcgccagtgatgacgtgatggccctcgacggcaaggtg
acggtgaatgactatgccctcgatcgccaccccgatatctcagcgctggtggccaatatt
ccaggccaaaatcaaaaagatcgcggcttactggagcccttgcagcacctggatttggtc
gggctagagggcaacatcggcattttgtgtaacgggacagggctgaccttggcgacgatg
gacttggtgtcccaggccgggggcaagccagcgaatttgctgaatgtggggcgcgagacg
aactttgagccgccggcccagtccctctgcggccgcattgcccagggactcgagcaggtg
gcgcgccacaagggggtgaaggtggtgctggtcaatatcttggggaatgtgacggactgt
gaggcggtgtcttcgctgattgcggagtggtggcagcgatcgcaccaatcgccgcgatcg
cgctcggtcccccaggtgatcgtgcgtctggtgggcgatcgcctggaggcggcccgcgaa
accctaagcgtcatcgagattccgatggtcgaagacctcgaagacgcggtcagccaagcg
gtcaagctggccaaggcctag

DBGET integrated database retrieval system