KEGG   Geitlerinema sp. PCC 7407: GEI7407_0446Help
Entry
GEI7407_0446      CDS       T02366                                 

Definition
Delta-9 acyl-phospholipid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gei01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:gei01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
548124..548942
Genome map
AA seq 272 aa AA seqDB search
MTLATPTKLSLNWPVITFMAVIHIGALFALLPSNFSWAAVGVALFLHWVTGGLGITLGLH
RLVAHRSFQTPKWLEYFLVFCASLAAQGGPIEWVGLHRHHHLHSDQSVDHHNSGKGFWWS
HMGWMLYEVPAKKEIHRFIKDIAEDPVYLFFDKYFLLVQAALGVVLYFLGGWPFVVWGVF
VRLVLVYHCTWFVNSATHKFGYRTYDAGDRSTNCWWVALVTYGEGWHNNHHAFQYSARHG
LRWWEIDMTWMTIRLLQMLGLATKVKLINNEQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttgcaactccaaccaaactttcactaaattggccggtcattacgtttatggcc
gtcattcacatcggggctctctttgccttgctgcccagcaactttagctgggcagccgtc
ggagtagcactcttcttgcactgggtgaccgggggacttgggattacgctcggtcttcat
cgactcgtggcgcaccgcagtttccaaactcccaaatggcttgaatatttcctggtgttc
tgcgctagccttgctgcccaaggtggacccattgagtgggtgggactgcatcgccaccac
cacctgcactcggatcaaagcgtcgatcaccacaactcgggcaagggcttctggtggagc
cacatgggctggatgctctacgaagtaccggccaaaaaggagatccaccgcttcatcaaa
gacattgccgaggatcctgtatacctcttctttgacaagtatttcttgctggtccaggct
gctctaggcgtggtcctctacttcttgggaggctggccgtttgtggtgtggggcgttttt
gtccgcctagtgctggtttatcactgcacctggtttgtaaacagcgcaacccacaagttt
ggctaccgcacctacgacgctggcgatcgctctaccaactgctggtgggttgccctcgtg
acctacggtgaaggctggcataacaatcaccacgcgttccagtattctgctcgccatggc
ctgcgctggtgggaaattgacatgacctggatgacgattcgccttctgcaaatgctgggg
ctggcgactaaggtaaaactgattaataacgaacagtag

DBGET integrated database retrieval system