KEGG   Geitlerinema sp. PCC 7407: GEI7407_0619Help
Entry
GEI7407_0619      CDS       T02366                                 

Definition
acireductone dioxygenase apoprotein (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GEI7407_0619
Enzymes [BR:gei01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     GEI7407_0619
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     GEI7407_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
752217..752774
Genome map
AA seq 185 aa AA seqDB search
MAILRLEDGTTYTELDAIARELAPLNVQLNHWPVSDDSRARSLLAQSALDADEKEQVLQS
LDHYFEQLQASDGYQSRDLIVLNPDIPNLDEMLAKFIQCHTHADDEVRYIVDGEGVFGFV
RPDGSQIALTVQPEEFINVPANTEHWFHLTASRRVKAVRYFTTTEGWVPVYTGTEVRLRP
EQLVA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcaattctgagactcgaagacgggaccacctacaccgagctagacgcgatcgcccgc
gagctagcgccgctgaacgtccagctcaaccactggcccgtgagcgatgattcaagggcg
cgatcgctgctggcccaatcagccctggacgcggacgagaaagagcaggtcctccagtcc
ctagaccactacttcgagcagctgcaagcctccgatggctaccagtcgcgagatttgatt
gtcttgaatcccgacattcccaacctcgatgagatgttggcgaaatttattcagtgccac
acccacgcagacgacgaagtgcgctacatcgtcgatggagaaggggtttttggatttgtg
cgccccgacggcagccagatcgccctcaccgtccagcccgaggaattcattaacgtcccc
gccaataccgagcactggtttcacctcaccgccagccgccgcgtcaaggccgtgcgctac
ttcaccaccaccgagggctgggtgcccgtgtacaccggcaccgaagtccggctgcgtccc
gagcagctggtggcctga

DBGET integrated database retrieval system