KEGG   Geitlerinema sp. PCC 7407: GEI7407_0702Help
Entry
GEI7407_0702      CDS       T02366                                 

Definition
alpha amylase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GEI7407_0702
Enzymes [BR:gei01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GEI7407_0702
Exosome [BR:gei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GEI7407_0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
845027..846676
Genome map
AA seq 549 aa AA seqDB search
MANNIEFQLFAPYNQGAALIGSFSDWEEIPMKKGDDGYFRTQVALEDGEYHYKFRVQSRS
WFLEPDAWVDIVDPYATDVDSPTQNGVVRIKDGQIIVDTYVWQNDDKPLPPDHELVIYEM
HISDFSGGEDDPLERGKFRHVIEKLDYLCDLGVNAIEIMPVKEYPGDYSWGYNPRYFCAV
ESSYGGSDGLKRLIDECHGRGIRVILDGVYNHSEASCPLTQIDHDYWYHHEPRDPDNNWG
PEFNYEHYDDNLDTYPARKFIGDVVRFWIEEYHIDGIRYDAARQMANYDFMHWIVQETKQ
AAGSKPFYNIAEHIPETTSITGLEGPMDGCWHESFYHCVLAHICGDTFDLEPLKDAIDGK
RQGFLGATNLVNYLTNHDHNHVLAELADRDIFDEAAFKRVKLGAALLMTAMGVPLIWMGE
EFGEYKYKSIEPSKIEWPLLANDLNQGLLNYYKGLLHLRKTNQALYGENVEFFHENPESR
VLAYTRWNDEGSRVVVVANFSDQFLAGYAVPNFPADGTWHEWTGDYDVEVGDRTLMTDLP
EYEAKVFVW
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaacattgaatttcagctatttgctccctacaaccaaggtgcagcactgatt
ggctcgttctccgactgggaagaaatccccatgaaaaaaggagacgatggctactttcga
actcaagttgctctagaagacggcgaatatcactacaaattccgggtccagtcccgcagc
tggttcctcgagcccgacgcctgggtcgacatcgttgatccctacgccacagacgtcgac
tcccccacgcaaaacggcgtcgtgcgcatcaaagacggccagatcatcgtggatacctac
gtctggcaaaacgacgacaagcccctgcccccggaccacgagctggtcatctacgagatg
cacatcagcgacttttcgggcggcgaagacgatcccctcgagcggggcaaattccgccac
gtgatcgaaaagctcgactacctgtgcgacctgggcgtaaacgccatcgaaatcatgccc
gtcaaggaataccccggagactacagctggggctacaatccccgctacttctgcgctgtg
gagtccagctacggcggctcggacgggctcaagcgactgattgacgagtgccacgggcgg
ggcattcgggtcatcctcgacggcgtctacaaccactccgaagcctcctgccccctcacc
cagattgaccacgactactggtatcaccacgagccccgcgatcccgacaacaactggggg
cctgaatttaactacgagcactacgacgacaacctagacacctacccggcccgcaaattt
attggggatgtggtgcgcttctggattgaggagtatcacattgacgggattcgctacgat
gcggctcgccagatggccaactacgactttatgcactggatcgtgcaggaaaccaagcag
gccgcaggctccaagcccttctacaacatcgcagagcatatcccggagaccacgagcatc
acaggcctagaggggccgatggatggctgctggcacgaaagcttttatcactgcgtgctg
gcccatatttgcggcgatacctttgacctggagccgctcaaggacgccattgacggcaag
cgacagggctttttgggcgcgaccaacttggtcaactacctgaccaatcacgaccataac
catgtgctggcagaactggccgatcgcgacatctttgatgaggctgccttcaagcgggtg
aagctaggagcggcgctgctgatgacggcgatgggggtgccgctgatctggatgggcgaa
gagtttggcgagtacaagtacaagagcatcgagccgtcgaagattgagtggccgctgctg
gcgaatgatctcaatcagggcctgctgaactattacaaggggctgctgcacctgcgcaaa
acgaatcaggctctctatggggagaatgtggagtttttccatgagaacccagagtcgcga
gtgctggcctacacgcgctggaatgatgagggctcgcgggtggtggtggtggcgaatttc
tcggaccagttcctcgcggggtatgcagtgccgaacttcccggcagatggcacctggcac
gagtggaccggggactatgacgtggaggtgggcgatcgcacgctgatgacagacttgcca
gagtacgaagcgaaggtctttgtttggtag

DBGET integrated database retrieval system