KEGG   Geitlerinema sp. PCC 7407: GEI7407_0772Help
Entry
GEI7407_0772      CDS       T02366                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gei03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
939166..939792
Genome map
AA seq 208 aa AA seqDB search
MRYPPTQRRFPVYTRPLARLIEQFQRLPGVGPKTAQRLALHILKRPEEEVYALAQALVEA
KQQVGVCSVCFHLSAEPVCEICRAPSRDSTTVCVVADSRDVIALERTREYKGKYHVLGGL
ISPMDGIGPDQLNIQPLVRRVSQNGIQEVILAISPSVEGETTTLYVGQLLKPFTRVTRIA
FGLPMGGDLEYADEVTLARALEGRRELD
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtatcccccgacccaaaggaggtttcccgtttacacgcgtccccttgcccgccta
atcgaacagtttcagcgtcttccgggcgttgggcctaaaacggctcagcggcttgctctt
catatcctcaagcgccccgaagaagaagtctatgcccttgctcaggccctcgtggaggcc
aagcagcaagtgggcgtttgctctgtctgctttcacttgtctgccgagccggtgtgcgaa
atctgccgggctcccagccgcgacagcaccacggtctgtgtggtcgccgactcccgagat
gtcatcgcgctggagcggacgcgcgagtacaaagggaagtaccacgtgctgggggggctg
atttcgcccatggacggcatcgggccagaccagctcaatattcagcctttggtgcgtcgg
gtcagccaaaacggaatccaggaggtgatcctggccattagtcccagcgtcgaaggggag
acgacgacgctctacgtcggtcagctgctcaagcccttcacccgggtcactcggattgcc
tttgggctgccgatgggcggcgacttggagtatgccgacgaagtgaccctggcccgcgcc
ctagaaggtcgccgcgagctcgactga

DBGET integrated database retrieval system