KEGG   Geitlerinema sp. PCC 7407: GEI7407_1183Help
Entry
GEI7407_1183      CDS       T02366                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GEI7407_1183
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GEI7407_1183
   00020 Citrate cycle (TCA cycle)
    GEI7407_1183
   00620 Pyruvate metabolism
    GEI7407_1183
Enzymes [BR:gei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GEI7407_1183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1413108..1414400
Genome map
AA seq 430 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLATII
VDAGGSAPVGNAIALIAETEAEIEQAQQRASTQSAPAAAPAAPAPSAAAPAAEAPSAASN
GASASPAAREGRLIVSPRARKLAKELKVDLSTLRGSGPHGRIVAEDVEAAAGRPASAPTV
QAASLTAAAPVVASAPAAAAPAPAPVVPGEVTPFNTLQKAVVQGMVASLQVPVFRVSYSI
GTDKLDQLYKQVKSKGVTMSALLAKAVALTLQKHPLLYAAYTDQGTHYNSAINVAVAVAM
DDGGLITPVLQNADQVDLYSLSRTWKDLVQRARVKQLQPQEYNSGTFTISNLGMFGVDTF
DAILPPGQGSILAIGAAKSQVVATGNGFSIQKQMQVNITCDHRIIYGAHAAAFLKDLADL
IENNTHSLTL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgaagttttcatgcccgctctgagctccacgatgaccgaggggaaaatcgtt
tcctgggtcaaatcgccgggtgacaaggtggaaaaaggtgaaaccgtcgttgtcgtggaa
tccgacaaggccgatatggacgtcgagtccttctacgaaggctacctggccaccatcatc
gtggatgcgggcggctccgcaccggtcggaaacgcgatcgccctgattgctgagaccgaa
gccgaaatcgagcaggcccagcagcgcgccagcacccagagcgcccctgccgctgcaccc
gccgcgcccgccccgtctgctgccgcccctgccgccgaagctcccagcgccgccagcaac
ggcgcctcggctagccccgccgcccgcgaaggccgcctcattgtctcgcctcgcgcccgc
aagcttgccaaagaactgaaagttgacctgtctactctgcgcggcagcggcccccacggc
cgcatcgtcgccgaagacgtcgaagcggccgctggacgtcccgccagcgcgccgaccgtc
caggctgccagccttactgcggctgcgccggtcgtcgccagcgcgcccgctgctgcggct
cccgctccggccccagtggtccccggcgaagtcacccccttcaacaccctccagaaggct
gtggtccagggcatggtggccagcctccaggttcctgttttccgggtcagctacagcatc
ggcaccgacaagctcgaccagctctacaagcaggtgaagtccaagggcgtgacgatgtct
gccctgctggccaaggccgtcgctctgaccctgcaaaagcatcccctgctctacgccgcc
tacacggatcaaggcacgcactacaacagcgccatcaacgtggcggtggcggtggccatg
gacgacggcggcctgatcaccccggtcctgcaaaacgctgaccaggtggatctctactcc
ctctcgcgcacctggaaagacctggtgcagcgggctcgggtcaagcagctacagccccaa
gagtacaactcgggcaccttcacaatttccaacctgggcatgtttggcgtcgataccttt
gacgcgatcttgccgccgggccagggttcgatcttggcgatcggcgctgcgaagtcccag
gtggtggccacggggaatggcttctcgatccagaagcaaatgcaggtcaatatcacctgc
gatcaccggatcatctatggagcgcacgcagcggctttcctcaaggatctggccgacctg
atcgaaaacaacacccactccctgacgctctag

DBGET integrated database retrieval system