KEGG   Geitlerinema sp. PCC 7407: GEI7407_1249Help
Entry
GEI7407_1249      CDS       T02366                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
gei00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gei01100  Metabolic pathways
gei01110  Biosynthesis of secondary metabolites
gei01130  Biosynthesis of antibiotics
gei01230  Biosynthesis of amino acids
Module
gei_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GEI7407_1249
Enzymes [BR:gei01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GEI7407_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE PIN_3
Motif
Other DBs
NCBI-ProteinID: AFY65743
UniProt: K9S6A7
Position
complement(1497387..1498274)
Genome map
AA seq 295 aa AA seqDB search
MQIRRRPPVSSVTVINLTYKIKTDEDQPNNILEEIVWHKETEVDQLRDRRPLVELKRQLA
SAPPVRNFAEALRQSKTQPALIAEVKKASPSKGVLREDFDPVAIAQAYEQGGATCLSVLT
DQRFFQGSFENLQRVRQAVDLPLLCKDFILYPYQLYQARIHGADAALLIAAILSDQDLQY
FLKVIKTLGMTALVEVHTLEELDRVLALDGVELIGINNRDLQTFKVDLQTTCDLLTARQQ
PLSDRSILVVSESGLFVPADLRRVAEAGAAAVLVGESLVKQPDPAQATAALLSEA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatccgccgtcgtccgcccgtttccagtgtgaccgttatcaatttgacctacaaa
atcaagacggacgaggatcagcccaacaacatcctcgaagaaatcgtgtggcacaaggaa
acggaggtcgatcagctgcgcgatcgccggcccctcgttgagctaaagcgccagctagcc
agcgcgcccccggtccgcaacttcgctgaggccctgcgccagagcaagacgcagcctgcc
ctgatcgcggaggtcaagaaagcctctcccagcaagggcgtgctgcgcgaagattttgat
ccagtggcgatcgcccaggcctacgagcagggcggcgcgacctgtttgtcggttctgacc
gaccagcgatttttccagggcagctttgagaacctccagcgggttcgccaagcggtggat
ctgcccctcctgtgcaaagacttcattctgtatccctaccagctttatcaggcgcggatt
cacggcgctgatgcggctctgctgatcgcggcaattttgtcggatcaagatttgcagtat
ttcctgaaggtgatcaaaaccctcggcatgactgccctggtggaggtgcacaccctagag
gagctcgaccgggtgctggccctcgacggcgtggagctgatcggcatcaacaatcgcgat
ctgcaaaccttcaaggtagatctgcaaacgacctgtgatctactgacagcgcggcagcag
ccgctgagcgatcggtctatcctagtggtcagtgagtcgggtctgtttgtgccggcggat
ctgcgccgggtagcagaggcaggcgccgcggcggttttggtgggcgaatccttggtcaag
cagcccgatcccgcccaggcgaccgctgccctcttgagcgaagcctag

DBGET integrated database retrieval system