KEGG   Geitlerinema sp. PCC 7407: GEI7407_1568Help
Entry
GEI7407_1568      CDS       T02366                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GEI7407_1568
Enzymes [BR:gei01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     GEI7407_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1878198..1878869
Genome map
AA seq 223 aa AA seqDB search
MTIAQNGSNGSASTSQIPQAQALSANGNGSAEVGHDEMMEAVRTMLLGVGEDPEREGLLK
TPKRVAEAMRFLTSGYSQSLDQLVNGAIFDEGHNEMVLVRDIDVFSLCEHHMLPFIGKAH
VAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQVAEAIQEILEPQGVAVVMEATHMCM
VMRGVQKPGSWTVTSAMVGVFEEEFKTREEFLNLIRHRPSILM
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgactattgctcaaaacggatccaacggttcggcatcgacttcccaaatccctcaggcc
caggctctctcggccaacggcaatggctctgcggaagtgggccatgacgagatgatggag
gcggtgcggacgatgctcctaggggtgggcgaagaccccgagcgtgaaggactgctcaag
acccccaagcgggttgctgaagcgatgcgcttcttgaccagcggctacagccagtccctc
gaccagttggtgaatggcgccatctttgatgaaggccacaatgagatggtcttggtgcga
gacattgatgtctttagcctctgcgagcaccacatgctgcccttcatcggtaaggcgcac
gttgcctacatcccgaaccaaaaagtggtgggtctgagcaagctcgctcgcattgtggag
atgtattctcgccgcttgcaggtccaagagcgtctgacgcgccaggtggctgaagcgatc
caagagatcctcgagccccagggtgtggcagtggtgatggaagcaacccacatgtgcatg
gtgatgcggggtgtccaaaagccaggttcttggacagtgaccagcgcgatggtgggtgtc
ttcgaggaagaattcaagacccgtgaggagttcctcaacctgattcgtcaccgtccgtcg
atcttgatgtaa

DBGET integrated database retrieval system