KEGG   Geitlerinema sp. PCC 7407: GEI7407_1654Help
Entry
GEI7407_1654      CDS       T02366                                 

Definition
cobaltochelatase (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GEI7407_1654
Enzymes [BR:gei01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     GEI7407_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1979770..1983519
Genome map
AA seq 1249 aa AA seqDB search
MPRIVLVAGFESFNADLYRQAAQMARSRCPDLEIAVFSDRDLVSQPAAIAAALAGADVFF
ASLLFDYDQVQWLRERVQEIPTRLIFESALELMSLTRLGQFVLGDKPKGMPKPVKFILDK
FGSGREEDKLAGYLSFLKVGPKLLKYIPFKKVQDLRNWLVIYGYWNAGGSENVAAMLWFL
ADRYLGLTVGEIPEAIETPNVGLLHPDHSGYFESPRAYWDWYQGRLTPEARDRPVVGLLL
YRKHVITHQPYIPQLIRHFEAAGLSPLPIFINGVEGHVAVRDLMTSAHEQAQRDRGVVEC
PSLSLDAVAVDAIVSTIGFPLVGGPAGSMEAGRQVEVAKRILSAKNVPYTVAAPLLIQDI
HSWTRQGVGGLQSVVLYALPELDGAIDPVPLGGLVGDQIYLVPERVKRLTGRVHQWVALR
RKPPAQRKIAVILYGFPPGYGATGTAALLNVPKSLLRFLQALREQGYSVGDLPETGEELI
DWVRSADEAYAGQMPAHVDFENDPVTTVPIRRLEKWLGYLLTRRIEKQWRSLADSGIRTL
ADRYLLGGVQLGNVWIGVQPPLGLSGDPMRLMFERDLTPHPQYAAFYQWLQREFQADAVV
HFGMHGTVEWLPGSPLGNTGYSWPDILLGNLPHLYLYAANNPSESILAKRRGYGVLISHN
VPPYGRAGLYKELVALRDLIAEYREDPVKNAVLREAIVKKISDTGLDADCPMPEAKKLGM
PLTPETARMFSAEAFGRYFAKLYEYLQVLENRLFSSGLHVLGEPPTAEALEGYLGAYFGE
RLPEKLVTAIAEGCDRAELERRFTLNGSAPAVTEGLQIRDLLAQNTDELTNLLRGLNGEY
IPPAPGGDLLRDGPGVLPTGRNIHALDPYRMPSPAAYERGRAIARQILEQHRAEHGSDPE
TVAVMLWGLDAIKTKGESLGILLELVGAVPLKEGTGRIVRYELLPLAELDHPRIDVLANL
SGIFRDSFGNLIELLDDLFRRAAEADEPEAQNFIRKHALALQAQGIDNASARLFSNPAGD
FGSLVNDRVTDANWESGDELGKTWRDRNAFSYGRRDRGQARPEVLETLLKSTDRIVQQID
SVEYGLTDIQEYYANTGGLKKAAEMGQGRKVTASFVESFSQDTTPRKLEDLLRMEYRTKL
LNPKWAEAMAAQGSGGAYEISQRMTALIGWAGTTDFKDNWVYDQAAETYALDPEMAQRLR
QANPEAFRNIVGRMLEAHGRDFWHPSAGTLDRLRDLYELTDEELEGVKV
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaatcgttcttgttgctggatttgagtcttttaacgctgatctgtatcgtcag
gctgcccagatggcgcgctctcgctgccccgatctggagattgcggtgttcagcgatcgc
gacctcgtgagccagccagcggcgatcgcggcggccctggccggagccgatgtctttttt
gccagcctgctgtttgactacgatcaggtgcagtggctgcgggagcgggtgcaggagatt
cccacccggctaatttttgaatcggccctagagctaatgagcctgacccgcctgggccag
tttgtcctgggagacaagcccaagggcatgcccaagccggtgaaattcatcttggataag
tttggcagcggccgcgaagaggacaagctggcgggctatctgagctttttgaaggtgggg
ccgaagctgctgaagtatattcccttcaagaaagtccaggatctgcgcaactggctggtg
atctacggctactggaatgccggtgggtccgagaatgtggccgccatgctgtggttcttg
gccgatcgctatctggggctgaccgtgggcgagattccggaggccatcgagacgcccaac
gtgggcctgctccatccggaccatagcggctactttgagtcgccgcgggcctactgggac
tggtaccagggccgcctgacgccggaagcgcgcgatcgcccggtggtggggctgctgctc
taccgcaagcacgtgattacccatcagccctacattccccagctgattcgccacttcgag
gcggcgggactgtcgcccctgcccatctttatcaatggggtcgagggccacgtggcggtg
cgggatctgatgaccagcgcccacgagcaggctcagcgcgatcgcggcgtggtggagtgc
ccctctttgtctctagacgccgtggcggtggacgccatcgtttcgaccattggctttccc
ctggtgggcgggccagcgggctccatggaggcagggcgtcaggtagaggtggccaagcgt
atcctcagcgccaaaaatgtgccctacacggtggccgcgccgctgctgattcaggacatt
cactcctggacgcgccagggggtcggcggcctccagagcgtggtgctctatgccctgccg
gagctggatggggccattgaccctgtgcccctggggggcctggtgggcgaccagatctat
ctggtgccggagcgggtgaagcgcctgacgggccgagtgcaccagtgggtggccctgcgt
cgcaaaccccccgcccagcgaaaaatcgcggtaattctctatggcttcccgccggggtac
ggcgcgacgggaacggcggctcttctgaatgtgccgaagtcgctgctgcgattcttgcag
gcgctgcgggagcagggctacagcgtgggggatctgccggaaacgggcgaagaattgatt
gactgggtgcgcagcgccgatgaggcctacgctggccagatgccggcccatgtggacttt
gagaacgaccccgtgacgacggtgcccattcgccgcctggagaagtggctgggctatctg
ctgacccgccgcatcgagaaacagtggcgatcgctcgctgacagcggcattcgcaccctg
gccgatcgctacctgctggggggcgtgcagctcggcaatgtctggatcggcgtccagccg
cccctgggcttgtcaggagaccccatgcggctgatgtttgagcgggacctgacgccccat
ccccagtacgcggccttttatcagtggctccagcgggagtttcaggcggacgcggtggtg
cactttggcatgcacggcacggtggagtggctgcccggttctcccctgggcaacaccggc
tattcctggccagatatcttgctgggcaacctgccccacctgtacctctatgcggccaac
aacccctccgaatcgatcttggccaagcgacggggctatggggtgctgatttcccacaat
gtgccgccctacggccgggccggcctctacaaggagttggtggcgctgcgggatctgatc
gccgagtatcgcgaagatccggtgaaaaatgcggtgctgcgggaggcgatcgtcaaaaag
atcagcgataccggcctggatgccgactgcccgatgcccgaggccaaaaagctggggatg
cccctgacccccgaaacggcccgcatgttcagcgccgaagcctttggccgctactttgcc
aagctctatgagtacctgcaagtgctcgaaaatcggctgttctcctcggggctgcacgtc
ctgggtgagccgccgacggccgaggcactggagggctatctgggggcctactttggggag
cgcctgccggagaagctggtgacggcgatcgctgaagggtgcgatcgcgccgagctagag
cgccgctttaccctcaatggctcagcccctgctgtgactgaagggctgcaaatccgggat
ctgctggcccaaaatacagacgagctgaccaacctgctgcggggtctcaacggggaatat
atccccccggctcccggcggcgacctgctgcgggacggtccaggggtgctgcccaccggc
cgcaatattcatgccctagacccctaccggatgccgtctccggcggcctacgagcgcgga
cgggcgatcgcccgccagattctcgagcagcatcgggccgagcacggcagcgaccccgag
accgtggccgtcatgctctggggcctcgacgccatcaagaccaagggcgaatccctgggc
atcctgctggagctggtgggcgctgtgcccctcaaggagggcacgggccggatcgtccgc
tacgagctgctgcccctggcagagctggatcatccgcgcattgacgtgctggccaacctg
tccggcattttccgagacagcttcggcaatctgatcgagctgctggacgacctgtttcgg
cgggcggcggaggccgacgagcccgaagcccaaaacttcattcgcaagcacgccctcgcc
ctccaggcccaagggattgacaatgcttcggcccgcctgttttccaatccggccggggac
tttggctccctggtaaatgaccgggtgaccgacgccaactgggaatcgggggatgagctg
ggcaaaacttggcgcgatcgcaacgcctttagctacggtcgccgcgatcgcggtcaggcc
cgccccgaagtcctggagaccctgctcaaaagcaccgatcgcatcgttcagcagatcgac
tcggtcgagtacggcctcaccgacattcaggagtactacgccaacaccggcggcctgaaa
aaagccgctgaaatgggccagggccgcaaagtgaccgccagctttgtcgagagcttttcc
caggacaccacccctcgcaagctagaggacctgctgcgcatggagtaccgcaccaaactc
cttaaccccaaatgggcagaggcgatggcggctcaggggtctggcggtgcctacgaaatt
tcccagcgcatgaccgccctgatcggctgggccgggacaacggacttcaaggacaactgg
gtctatgaccaggccgccgagacctacgccctcgatcccgagatggcccagcgcctgcgc
caagccaaccccgaagcctttcggaacatcgtggggcgaatgctggaggcccacggccgc
gacttctggcatccgtcggcgggcaccttggatcggctgcgcgacctctatgaactgacc
gacgaggagctggagggtgtcaaagtttag

DBGET integrated database retrieval system