KEGG   Geitlerinema sp. PCC 7407: GEI7407_1754Help
Entry
GEI7407_1754      CDS       T02366                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GEI7407_1754
Enzymes [BR:gei01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     GEI7407_1754
Peptidases [BR:gei01002]
 Cysteine Peptidases
  Family C44
   GEI7407_1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2130701..2132440
Genome map
AA seq 579 aa AA seqDB search
MTVSVATCPQQLVGYWGYGDPARLGQSLKRLLSQARETDWAVTSQPTSDGTLAVLSAAGL
ASDLQTETALADIWVQVGEQSLTLGRQAFGRVPLYWMQVEQVIWFSSRLQTLLPLVASPG
VNFAALYGYSCFSYVPTPLTPVEGVVAVPAGVEETWRMSAGTLASPHSRDLLDWREVPDP
VDNEQAAIAQLQTLLKAAVERQITDLPDETVGVLLSGGLDSSIVAALLVQMGVKVRAYTL
DFGDEFERGGMTESPYAEQVASWLNIPLIKVDATPRRIQAALIPTIKALDLPFGDGVTVP
LSLLCQAASQDTGIIFNGEGGDQLFAGWTNKPLIAASIYQSEHPDDYQSFADHYLRTFHR
LWGYEAQVFQPAVYAAIQDMNPQDWLYPALDPTETRSLLHRLRRASLMLKGAQNIHPRAT
NLAFAHGLQVRSPFCDMALAQWTFQVSSELYLQGACEKYILKRAVEPWLPPEIVWRQKRG
MGVPLTAWCLNEWWRSLGVWLNPGTLQAEGRWQPDLAARIVEGNLGGMIQGRRIGETLWL
LIVWQLWRSHVLGEPLENPSWNHPFLLPYQLWRFTHRCL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcagcgttgccacctgtccacagcagctcgtggggtattggggctatggcgat
ccggcaagattagggcaatcgttgaagcggcttttatcccaagctagggaaacagactgg
gccgtcacttctcagcctacttctgatggcaccttggcggttttgtctgcggctggtttg
gcctctgatctacagacagagactgccttagctgatatctgggtacaggtgggagagcag
agcttgaccctgggacgacaagcctttggacgagtgccactctactggatgcaggttgag
caggtgatctggttttcctcgcggttacaaacgctcctgccactcgtagcctctccaggc
gtcaactttgctgctttgtatggctatagctgtttctcctatgtgcccacgccgttaacc
cccgttgaaggggttgtcgctgtacctgctggagttgaggaaacttggcgaatgagcgcg
ggaaccctggcatctcctcactcccgcgatctcttggactggcgagaagtacctgaccca
gtggacaacgagcaagcggcgatcgctcaactccaaactctcttaaaagcggcggttgaa
cggcaaatcactgacctgcctgatgagacggtcggtgtgctgctgtcggggggcttagac
tcttcgattgtggcagcgctgctggtgcaaatgggggtgaaagtacgtgcctacaccctc
gattttggggatgagtttgagcgcggaggcatgacagaatctccgtacgccgagcaggtt
gctagctggctaaacattcctctgattaaagtcgatgctactccccgacggattcaggct
gctttgattcccacgattaaagcgttggatctaccctttggggatggagtcacggttccc
ctgtctttgctctgtcaggcggccagtcaggacaccggcattatcttcaatggtgaagga
ggtgaccagttatttgcggggtggacgaacaaaccgctgattgccgccagcatttatcaa
tcggagcatcccgatgattatcagtcgttcgccgaccattatctacgaacctttcatcgc
ctctgggggtatgaagcacaggtatttcagcccgctgtttatgctgcaattcaggatatg
aatcctcaggattggttatatcccgcattagacccgaccgaaactcgatcgctcctccat
cgactgcgccgagcctctctgatgctgaagggagcccaaaatatccacccacgagcaact
aacctggcgtttgcccacggcttgcaggttcgatcgcccttttgtgacatggcgcttgcc
caatggacttttcaagtgtcgagtgaactgtatttgcagggagcgtgcgagaaatatatt
ctcaagcgggcggtagaaccctggctccctccagagattgtgtggcggcaaaagcgcggg
atgggggttcctttgaccgcgtggtgtttgaatgaatggtggcgatcgctgggagtctgg
ttgaatcctggtactttacaagcagaaggacgatggcagcctgatttagcagcgcgtatt
gttgaaggtaatttaggaggcatgattcaggggcgacggattggtgaaaccctttggtta
ttgattgtttggcaattgtggcgatcgcacgttctgggtgaacccctagagaatccatcc
tggaaccatccttttttactgccctatcagttgtggaggtttactcaccgatgtctctag

DBGET integrated database retrieval system