KEGG   Geitlerinema sp. PCC 7407: GEI7407_1921Help
Entry
GEI7407_1921      CDS       T02366                                 

Definition
alcohol dehydrogenase AdhE, acetaldehyde dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GEI7407_1921
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GEI7407_1921
   00620 Pyruvate metabolism
    GEI7407_1921
   00650 Butanoate metabolism
    GEI7407_1921
  Lipid metabolism
   00071 Fatty acid degradation
    GEI7407_1921
  Amino acid metabolism
   00350 Tyrosine metabolism
    GEI7407_1921
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GEI7407_1921
   00626 Naphthalene degradation
    GEI7407_1921
Enzymes [BR:gei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GEI7407_1921
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GEI7407_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2338470..2341106)
Genome map
AA seq 878 aa AA seqDB search
MKVTNLEELQALIQRVKSAQNTFSTYSQAQVDAIFKKAAIAANAQRIPLAKLAVSETGMG
LVEDKVIKNHFASEYIYNKYKHEKTCGVLEEDKTFGFQTLAEPVGILAGIVPTTNPTSTT
IFKALIALKTRNGIIFSPHPRAKQCTIEAARIILQAAVAAGAPEHIIGWIDEPTVPLSQA
LMQHPDIKLILATGGPGMVKAAYSSGHPSLGVGAGNTPAVIDETAHIKMAVSSILLSKTF
DHGMICASEQSVIVVDEVYEAVKAEFRDRGAYFLTPDERDRVAQIILTNGHLNPEIVGQS
AEAIAHLAGLDLTAGDREVPPKVLIGEVEVVGPQEAFAYEKLSPILAMYRAANFGEAVAK
AEALVNFGGRGHTAVLYTNPGNTAHIQAFETQIETSRVLINTPSSQGAIGDLYNFRLDPS
LTLGCGSWGDNSVSVNVGPKHLLNIKTVTERRENMMWFRVPPKVYFKYGCLPVALRELAG
RQRAFIVTDKPLFDLGMTQGAIAVLEEMGLKTQVFYDVEPDPSLATVHKGLAEIQSFQPD
VILAIGGGSPMDAAKVMWLMYEQPDVEFEGLATRFMDIRKRVYEVSPLGQKALMVCVPTT
SGTGSEVTPFAVVTDDRTGIKYPLADYALTPSMAIADPDLVMHQPKKLTAYGGIDALTHA
LEAYVSVFATEFSNGMALEAIRLLMKYLPAAYQEGAANPKAREKVHYAATMAGMAFANGF
LGICHSLAHTLGSTFHVPHGLANGLLITHVIRYNATDVPFKQAIFPQYKYPNTKWRYARV
ADYLGLGGQSDDEKVENLIAAIATLKQQLEIPATLRDALAVEESVFRARVESMADQAFDD
QCTGTNPRYPLINDLRDLYLSAYYGSAQETTVPEPARS
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcaccaatttagaagagctgcaagccctcattcagcgcgtcaaatcggcccaa
aataccttttcgacctattcccaagcccaggtagacgccattttcaaaaaagcggcgatc
gcggccaacgcccagcgcattcccctagccaagctggcggttagcgagactgggatgggc
ttggtagaagataaagtcatcaaaaatcactttgcctccgaatatatctacaacaagtac
aaacatgagaaaacctgcggcgttttagaagaagacaagacctttggctttcagaccctg
gccgagcccgtggggatcctggcggggatcgtgcccaccaccaaccccacttccacaacc
atctttaaggccctgatcgccctcaaaacccgcaacggcattatcttttcgccccacccg
cgcgccaagcagtgcaccatcgaagcggctcgcatcatcctccaagcggcggtggcggct
ggcgcgccggagcatatcatcggctggatcgatgagccgacggtgccgctctcccaggcc
ctgatgcagcaccccgacatcaagctgatcctggcgacggggggaccgggcatggtgaag
gcggcctactcttcggggcacccgtccctgggggtgggcgcgggcaataccccggcggtg
atcgacgagacggcccatatcaaaatggcggtctcctcgatcttgctgagtaaaaccttt
gaccacggcatgatctgcgccagtgagcagtcagtgatcgtggtggatgaggtttacgag
gcggtgaaggccgaatttcgcgatcgcggcgcctacttcctgaccccggacgagcgcgat
cgcgtggcccagatcatcctgaccaacggccacctgaacccagagatcgtgggccagagc
gcagaggcgatcgcccatctagcgggcctcgatctcacagcgggcgatcgcgaggttcct
cccaaggttctcattggcgaggtcgaagtggtcggcccccaggaagccttcgcctacgaa
aagctctcgcccattttggccatgtaccgggccgcgaacttcggggaagctgtggccaag
gcagaagccctcgtgaacttcggcggtcggggccataccgctgtcctctacaccaacccc
ggtaacaccgcccatatccaggccttcgagacccagatagagacctctcgggtcttgatc
aacacgccctcgtcccagggcgcgatcggcgatctctacaatttccggctggatccctct
ctcaccctcggctgcggcagctggggcgataactctgtctccgtcaacgtcggccccaaa
cacctgctgaacatcaagaccgtcaccgagcggcgggagaacatgatgtggttccgggtg
ccgccgaaggtctactttaaatacggctgtctgccggtggcgctgcgggaactggccggt
cgccagcgggcatttatcgtgacggacaagccgctgtttgatctggggatgacccaggga
gcgatcgccgttttggaagaaatgggcctgaaaacccaggtcttttatgatgtggagcca
gatccgtctcttgccaccgtccacaaaggattggctgaaattcagagcttccagcccgac
gtgatcctggccattggcggcggatcgcccatggacgcggccaaggtgatgtggctgatg
tatgagcagcccgacgtcgagtttgagggactggcgacgcgctttatggatatccgcaag
cgggtatatgaagtctcacccttgggccaaaaagctctgatggtttgcgtgcccacgacc
tccgggaccgggtctgaggtcactccctttgcggtggtgaccgacgatcgcacggggatc
aaatatcccttggcggactatgccctgacgccgtccatggcgatcgccgatcccgatctc
gtgatgcaccagcccaagaagctgacggcctacggcggcattgacgccttgacccacgcc
cttgaggcctatgtctcggtctttgccaccgagtttagtaacggcatggctctggaggcg
atccgcctgctgatgaagtatctcccggcagcctatcaggaaggcgccgctaatccgaag
gcgcgggaaaaagtccactacgcggcgaccatggccgggatggcctttgccaatggattt
ttggggatttgccactccctggcccataccttgggctcgacgttccatgtcccccacggc
ttggccaacgggctgctgatcacccacgtgatccgctacaacgccaccgatgtgcccttc
aaacaggccatcttcccccaatacaaataccccaataccaaatggcgctatgcccgggtg
gcggactacctcggtttggggggccaaagtgatgatgagaaagtagaaaacctcatcgcg
gcgatcgccacgctcaagcagcagctagagattccggcgacgctgcgggatgcgctggca
gtggaggagtctgtcttccgggcgcgggtggaaagcatggccgaccaggcctttgacgat
cagtgcaccggcaccaacccccgctatccgctgattaatgacctgcgggatctctatctg
tcggcctactacggcagtgcccaggagacaacggttcctgaaccggctcgatcctag

DBGET integrated database retrieval system