KEGG   Geitlerinema sp. PCC 7407: GEI7407_1975Help
Entry
GEI7407_1975      CDS       T02366                                 

Definition
Delta-9 acyl-phospholipid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    GEI7407_1975
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    GEI7407_1975
Enzymes [BR:gei01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     GEI7407_1975
Lipid biosynthesis proteins [BR:gei01004]
 Desaturase
  First
   GEI7407_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2410610..2411452
Genome map
AA seq 280 aa AA seqDB search
MKPQLEFDSSETLKLDWKTVLFFAAVHGLALLAIPFFSWSALGVMLGLHWLFGSIGICLG
YHRLLSHRSFRVPRWLERSIALLGALALQGGPIFWVAGHRLHHAYTEDEQKDPYSARRGF
WWSHVLWIFYPRSQFFDYEEYQRFAPDLARDPFYRWLNRYFFWLQFPLALLLYFVGGWSF
VVYGIFVRAVFLWHTTWLINSVTHLWGSRAFDCRDNSRNLWWAALLTYGEGWHNNHHAYP
QVARCGWRWWEIDVTWWAIALLQRLGLATAVQNPPTSASR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccacaacttgagtttgattcgagcgaaacgctgaagctggactggaaaacggtg
ctgttttttgcggcagtccatgggttagcgctcctcgccattccctttttctcttggtcg
gcgctgggggtcatgctcggcctgcactggctgtttgggagtattgggatctgtttggga
tatcatcggctgctgagccaccggagctttcgggtgccgcgctggctggagcgatcgatc
gcccttttgggggctttggcgctccagggtgggccgatcttctgggtggcggggcatcgt
ctccaccacgcctacaccgaggacgaacaaaaagatccctattctgcgcgtcggggattt
tggtggagtcatgtcctgtggattttctatccgcgatcgcagttttttgactacgaggag
tatcagcgctttgcgccggatttggcgcgcgatcccttctaccgctggctcaatcgatac
tttttctggctgcaatttcccctagcgctgctgctctactttgtcggtggctggtctttt
gtggtgtacggcatctttgtgcgggcggtctttttgtggcacaccacctggctgattaat
tcggtgacccacctgtggggcagccgagcatttgactgtcgcgacaactctcgcaatctt
tggtgggcagccctgctcacctacggcgaaggctggcacaacaatcaccacgcctatccc
caagtggctcggtgcggctggcgctggtgggagatcgacgtgacctggtgggcgatcgcc
ctcttgcagcggttgggcctagccacagcggtgcaaaatcccccgacctcagcgtctcgc
tga

DBGET integrated database retrieval system