KEGG   Geitlerinema sp. PCC 7407: GEI7407_2168Help
Entry
GEI7407_2168      CDS       T02366                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:gei00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GEI7407_2168
Enzymes [BR:gei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GEI7407_2168
Two-component system [BR:gei02022]
 CheA family
  WspE-WspRF [MD:M00509]
   GEI7407_2168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2659497..2660525)
Genome map
AA seq 342 aa AA seqDB search
MLKIAIVNDSPMALEVLRRLVSQTPHYQVSWTAQDGAEAVARCAADLPDLILMDVVMPIM
DGVEATRRIMASTPCAILMVTASVNRYAAEVFTAMGYGALDAINTPAIGLQFASEGGKGL
LKKISAIATLIGKAPRRSLLRDTPRPALVSRRSRSPLIAIGSSTGGPQALAKILSALPAT
LDASIVVVQHVDEQFAPGLAHWLNDQTPLTVDIAQEGQAPSPGHVSIAGTNDHLCLSPSG
KFTYCAEPQTTYRPSVDALFASLAQHWPQPDIAVILTGMGQDGAQGLKLLRDAGWRTIAQ
DRKTSVVYGMPRAAFELGAVESVLPLEAIAPACLDHLSKIPY
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaaaattgcgatcgttaatgactcacccatggctctagaagtcttgcggcgcttg
gtgtcgcaaacgcctcactaccaagtgagttggacggcccaggacggtgccgaagccgtg
gctcgctgcgccgccgacctgcccgacttgatcttgatggatgttgtgatgcccatcatg
gacggagtggaggcaacccgccgcatcatggcctcgacgccttgtgcgattttgatggtg
accgccagcgtcaatcgctacgccgccgaggtgttcacggccatgggctacggcgcgctg
gatgccatcaatacgccagccatcggtctccagttcgcctccgagggcggcaaaggcctg
ctcaagaagatcagcgcgatcgccacgctgatcggcaaagcaccccgccgctccctgctg
cgcgatacgccgcgtccggccctggtttcccggcgatcgcgatcgcccctgatcgccatc
ggctcctccaccggcggtccccaggccctcgccaaaattttgtccgctctcccggccacc
ctcgacgccagcatcgttgtggttcagcacgtcgatgagcagtttgccccggggctagcc
cactggctcaacgatcaaacccccctaaccgtcgacattgcccaggaaggacaggccccg
tctcccggccatgtatcgatcgctggcaccaacgaccacctctgtctctctcccagcggt
aagttcacctactgcgctgagccccagaccacctaccggccatccgtggacgctctgttt
gccagccttgcccagcactggccccagcctgacatcgccgtcatcctcaccggcatgggc
caagacggcgcccagggcctcaagctcctgcgggacgctggctggcgcacgatcgctcag
gaccgcaaaacctcggtagtctacggaatgcctcgggctgccttcgagctgggggccgta
gagtccgtcttgcccctagaggcgatcgcccctgcctgtctagaccacctcagtaaaatc
ccttactaa

DBGET integrated database retrieval system