KEGG   Geitlerinema sp. PCC 7407: GEI7407_2217Help
Entry
GEI7407_2217      CDS       T02366                                 

Definition
(GenBank) carbohydrate ABC transporter membrane protein 2, CUT1 family
  KO
K02026  
multiple sugar transport system permease protein
Organism
gei  Geitlerinema sp. PCC 7407
Module
Putative multiple sugar transport system
Brite
Transporters [BR:gei02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    GEI7407_2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2733206..2734090
Genome map
AA seq 294 aa AA seqDB search
MTTTHQPTPTQTENPYEKRQRIRNIAIALGVFLTVVISLAPILWQVLTSIKVNADISAVP
NVYIPSRYTLEHYILLFERRPFLRYIFNSAFVAIVSTVLALGLGAPAAYALARMRIPGER
IILGIILIVVLFPYILLFLGLLQVVQALGIGNNYLVLIVPYTAINLPLTILTLRSFFLQL
PKDLEDAAKVDGYSTLGMLLKIVLPMTLPALVTTGILAFIFAWNEYIFALTFVTRESLKT
IPVAAAQLSGATLFSIPYGPLAAATSLGTFPLIILVLIFQRKIVQGLTSGAVKG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgactcatcaacccacccctactcaaaccgagaatccctacgaaaagcgccag
cgcattcgcaatatcgcgatcgcccttggcgtgtttttgaccgtggtgatcagccttgcc
cccatcctgtggcaggtgctgacgtcgatcaaggtcaacgcggatatctctgctgtcccc
aatgtctatattcccagtcgctataccctcgagcactatattttgctgtttgagcggcgg
cctttcctgcgctatatcttcaacagcgcttttgtcgccattgtctctacggtgcttgct
ttgggactgggtgctcccgctgcctacgctctggcgcgtatgcggatcccgggagagcgc
atcattttgggaattattttaattgtcgttttgttcccttatattttgctgttcttgggt
ctgctgcaagtggtgcaggccttgggcatcggcaacaactatctggtgctgatcgtgccc
tacaccgccattaacctgcccttgaccattctcaccctgcgcagcttctttcttcagttg
cccaaagatctcgaagatgcagccaaagtggacggctacagcaccctgggcatgctgctg
aaaatcgtgctgcccatgaccctccccgcgctggtcaccacaggcattttggcctttatc
tttgcctggaatgagtatattttcgcgctgaccttcgtgacgcgagagtctctcaaaacg
atccccgttgcagcggcccagctcagcggcgcgacgctattcagcattccctacggtccc
ctggccgccgcgacgtctctgggaacctttccgttgattattctggtgctgatcttccag
cgcaagatcgttcagggtctcacctccggcgcggttaagggatag

DBGET integrated database retrieval system