KEGG   Geitlerinema sp. PCC 7407: GEI7407_2221Help
Entry
GEI7407_2221      CDS       T02366                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gei00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2738312..2739817)
Genome map
AA seq 501 aa AA seqDB search
MTHASAAYILALDLGTTGNRALLFDREGRVVSQAYREMTQYYPQPGWLEHDPREIWEQTH
WAIQTAIQKAQIAPEAIAAVGLTVQRETCLLWDKTTGRPLHNAIVWQDRRTAYRCNQLRA
DGYAEMVRDRTGLVLDAYFSATKIAWLIDRVQPEQPPVDWSNILAGTVDSWVLWNLTGGK
VHATDHSNASRTMLMNLESLAWDEKLLELFGIPASLMPEIRPSFGYFGHTDKAIVGAEIP
IMAILGDQQAALLAHGCDRPGLLKCTYGTGCFLIAHTGETLTRSDHQLLSTVAWSRDRSV
GFALEGSMFTAGACIQWLRDGLKLITSAADTQPMAESVSDNGGVYFVPALSGLGAPHWDM
SARGAFLGLTGAARREHLVRSVLEAIAFQVKEVVEAMNQDGGTQIQRLKVDGGACQNDFL
MQFQADALGIEVERPAVLDATAQGAAFAAGLAAGFWDDYGALVSARQVDRVFRPGKAAAQ
VQAQAEIWQRALERAKHWTED
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgactcacgcttctgctgcctatatcctggccctggatctgggaacgacggggaatcgg
gcgctgctgtttgatcgcgagggccgtgtggtcagtcaggcctaccgcgagatgacccag
tattatccccagcccggatggctagagcatgacccccgagagatctgggagcagactcac
tgggccatccaaacggcaatccagaaggcccaaatcgcgccagaggcgatcgccgccgtg
ggcctgacggtgcagcgcgaaacctgtctgctgtgggacaaaaccacgggccgcccgctc
cacaacgccatcgtctggcaggaccgccgcaccgcttaccgctgcaaccagctccgcgcc
gacggctacgccgagatggtgcgcgatcgcactggcctggtcctcgatgcctacttctcc
gccaccaagatcgcctggctgatcgaccgggtgcagccggagcagccgccggtggactgg
tcaaatatcctggcgggtacggtggacagctgggtgctgtggaacctgaccggcggcaag
gtccacgccacggaccacagcaacgccagccgcaccatgctgatgaatctggagtccctc
gcctgggacgaaaagctgctggagctgtttggcattccggcgtcgctgatgcccgagatc
cgccccagttttggctacttcgggcacacggacaaggcgatcgtgggggcggagatcccg
attatggcgatcttgggcgatcagcaggcggcgctgctggcccacggctgcgatcgcccc
ggcctgctgaagtgtacctacggcaccgggtgtttcttgattgcccacaccggcgagacc
ctgacccgctcggatcaccagcttttgtccacggtggcctggagccgcgatcgcagcgtg
ggcttcgccctggagggcagtatgttcaccgccggggcctgcatccagtggctgcgggac
ggcctcaagctgatcacctcggccgcagacacccagcccatggccgagagcgtcagcgac
aatggcggcgtctattttgtcccggccctgagcggcttgggggctccccactgggatatg
agcgcgcggggggcgtttctgggcctgacgggggcggctcggcgcgagcacctggtgcga
tcggtgctggaggcgatcgccttccaggtcaaggaagtggtcgaggccatgaaccaggac
ggcggcacccagatccagcgcctcaaggtcgatggcggagcctgccaaaacgacttcctg
atgcagtttcaggcggatgctctgggcatcgaggtggagcggccagcggtcctagacgcg
acggcccaaggggctgcctttgcggcggggctagcggcgggcttctgggacgactacggc
gcgctggtgtcggctcgccaagtcgatcgggtcttccgaccggggaaggcggcggcccag
gtgcaggcccaggcggagatctggcagcgggcgctggagcgggccaagcactggaccgaa
gactaa

DBGET integrated database retrieval system