KEGG   Geitlerinema sp. PCC 7407: GEI7407_2221Help
Entry
GEI7407_2221      CDS       T02366                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    GEI7407_2221
Enzymes [BR:gei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     GEI7407_2221
Exosome [BR:gei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GEI7407_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2738312..2739817)
Genome map
AA seq 501 aa AA seqDB search
MTHASAAYILALDLGTTGNRALLFDREGRVVSQAYREMTQYYPQPGWLEHDPREIWEQTH
WAIQTAIQKAQIAPEAIAAVGLTVQRETCLLWDKTTGRPLHNAIVWQDRRTAYRCNQLRA
DGYAEMVRDRTGLVLDAYFSATKIAWLIDRVQPEQPPVDWSNILAGTVDSWVLWNLTGGK
VHATDHSNASRTMLMNLESLAWDEKLLELFGIPASLMPEIRPSFGYFGHTDKAIVGAEIP
IMAILGDQQAALLAHGCDRPGLLKCTYGTGCFLIAHTGETLTRSDHQLLSTVAWSRDRSV
GFALEGSMFTAGACIQWLRDGLKLITSAADTQPMAESVSDNGGVYFVPALSGLGAPHWDM
SARGAFLGLTGAARREHLVRSVLEAIAFQVKEVVEAMNQDGGTQIQRLKVDGGACQNDFL
MQFQADALGIEVERPAVLDATAQGAAFAAGLAAGFWDDYGALVSARQVDRVFRPGKAAAQ
VQAQAEIWQRALERAKHWTED
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgactcacgcttctgctgcctatatcctggccctggatctgggaacgacggggaatcgg
gcgctgctgtttgatcgcgagggccgtgtggtcagtcaggcctaccgcgagatgacccag
tattatccccagcccggatggctagagcatgacccccgagagatctgggagcagactcac
tgggccatccaaacggcaatccagaaggcccaaatcgcgccagaggcgatcgccgccgtg
ggcctgacggtgcagcgcgaaacctgtctgctgtgggacaaaaccacgggccgcccgctc
cacaacgccatcgtctggcaggaccgccgcaccgcttaccgctgcaaccagctccgcgcc
gacggctacgccgagatggtgcgcgatcgcactggcctggtcctcgatgcctacttctcc
gccaccaagatcgcctggctgatcgaccgggtgcagccggagcagccgccggtggactgg
tcaaatatcctggcgggtacggtggacagctgggtgctgtggaacctgaccggcggcaag
gtccacgccacggaccacagcaacgccagccgcaccatgctgatgaatctggagtccctc
gcctgggacgaaaagctgctggagctgtttggcattccggcgtcgctgatgcccgagatc
cgccccagttttggctacttcgggcacacggacaaggcgatcgtgggggcggagatcccg
attatggcgatcttgggcgatcagcaggcggcgctgctggcccacggctgcgatcgcccc
ggcctgctgaagtgtacctacggcaccgggtgtttcttgattgcccacaccggcgagacc
ctgacccgctcggatcaccagcttttgtccacggtggcctggagccgcgatcgcagcgtg
ggcttcgccctggagggcagtatgttcaccgccggggcctgcatccagtggctgcgggac
ggcctcaagctgatcacctcggccgcagacacccagcccatggccgagagcgtcagcgac
aatggcggcgtctattttgtcccggccctgagcggcttgggggctccccactgggatatg
agcgcgcggggggcgtttctgggcctgacgggggcggctcggcgcgagcacctggtgcga
tcggtgctggaggcgatcgccttccaggtcaaggaagtggtcgaggccatgaaccaggac
ggcggcacccagatccagcgcctcaaggtcgatggcggagcctgccaaaacgacttcctg
atgcagtttcaggcggatgctctgggcatcgaggtggagcggccagcggtcctagacgcg
acggcccaaggggctgcctttgcggcggggctagcggcgggcttctgggacgactacggc
gcgctggtgtcggctcgccaagtcgatcgggtcttccgaccggggaaggcggcggcccag
gtgcaggcccaggcggagatctggcagcgggcgctggagcgggccaagcactggaccgaa
gactaa

DBGET integrated database retrieval system