KEGG   Geitlerinema sp. PCC 7407: GEI7407_2226Help
Entry
GEI7407_2226      CDS       T02366                                 

Definition
(GenBank) NAD-dependent glycerol-3-phosphate dehydrogenase domain protein
  KO
K00057  
glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GEI7407_2226
Enzymes [BR:gei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     GEI7407_2226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2747172..2748179
Genome map
AA seq 335 aa AA seqDB search
MVSNLTQVQSTPKTSFSKGAIAPLNPFPSRTSTATATVLGAGAWGSALATLLRRNGHDVR
VWSRRSNETLEEAIAGVDVIVSAIPMKGVSATVEALQEFTLPANMLVVTATKGLDPNTAE
TPSQIWQQAFPEHPVVVLSGPNLSKEIQQGLPAASVAASTSPQAAEEVQKLFSSDAFRVY
TNDDPLGTELGGTLKNVIAIAAGICDGLELGTNAKAALISRALAEMVRVGLHFGAKAETF
CGLSGLGDLLATCDGPLSRNYRVGQGLATGKSLTQVLEDLKSTAEGVNTTQVLMGIAQEN
QLDLPIARCVYSVIRGKVSPQRAVEGLMGRELTAE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcaatctaacccaagtccaatccactcccaaaacttcctttagcaaaggggcg
atcgctcccctcaatccctttccctcccgaacttctacagcaacggccacagtccttggg
gccggagcctggggcagcgccctggctaccctcctgcgccgcaacggccacgatgtccgg
gtatggtcccggcgctcgaacgaaaccctagaagaggcgatcgcgggcgtcgatgtgatc
gtttctgcaattcccatgaagggcgtcagcgccacggtagaggctctccaagagttcacc
ttaccggccaatatgctggtggttacagccaccaagggactagatcccaacaccgccgaa
acgccctcccagatttggcagcaggcctttcccgagcatccggttgtagtgctttccggc
cccaatctctctaaggagattcagcagggtctccccgccgccagcgtggccgccagcacc
agcccccaggccgccgaagaagtgcagaaactcttttcttcggacgcttttcgggtctat
accaatgacgatcccctcggcacagagctcgggggcaccctcaaaaacgtcatcgcgatc
gccgctggcatctgcgacggcctcgagctcggcaccaacgccaaagccgccctgatcagc
cgcgccctcgccgagatggtgcgggtcggtctccactttggcgcgaaagcagagacattt
tgtggcctatcgggcctaggagatttgctggccacctgtgacggccccctcagccgcaac
taccgcgtcggccagggtctggccaccggcaaatctctcacccaggtgctcgaagatctc
aagagcacagctgaaggtgtgaacaccactcaggttctgatgggtatcgcccaggagaac
cagttagatctgccgatcgcccggtgcgtctacagtgtcattcgcgggaaagtctctccc
caaagagctgtagaaggcctaatggggcgagagctgacggctgagtaa

DBGET integrated database retrieval system