KEGG   Geitlerinema sp. PCC 7407: GEI7407_2227Help
Entry
GEI7407_2227      CDS       T02366                                 

Definition
(GenBank) carbohydrate ABC transporter ATP-binding protein, CUT1 family
  KO
K10112  
multiple sugar transport system ATP-binding protein
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
ABC transporters
Module
alpha-Glucoside transport system
Putative multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:gei00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    GEI7407_2227
Transporters [BR:gei02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194] [OT]
    GEI7407_2227
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491] [OT]
    GEI7407_2227
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    GEI7407_2227
   alpha-Glucoside transporter [MD:M00201] [OT]
    GEI7407_2227
   Glucose/mannose transporter [MD:M00605] [OT]
    GEI7407_2227
   Cellobiose transporter [MD:M00206] [OT]
    GEI7407_2227
   N,N'-Diacetylchitobiose transporter [MD:M00606] [OT]
    GEI7407_2227
   Putative fructooligosaccharide transporter [MD:M00197] [OT]
    GEI7407_2227
   Putative sorbitol/mannitol transporter [MD:M00200] [OT]
    GEI7407_2227
   Arabinosaccharide transporter [MD:M00602] [OT]
    GEI7407_2227
   Putative multiple sugar transporter [MD:M00207]
    GEI7407_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2748358..2749431)
Genome map
AA seq 357 aa AA seqDB search
MAKLEIRNLNKTYNRKTVPVKDISLDVSDNEFLTLLGPSGCGKSTTLRLIAGLEQPTRGQ
VLIGSQDVTNLRPGDRNIAMVFQSYALYPHMSVFENMASSLKLRKTPSDEIHQRIGDATR
VLGLEGLMDRKPSQLSGGQRQRVALGRALVRRPDVFLLDEPLSNLDALLRERVRADIKQL
FESQQVPVVYVTHDQTEAMTLSTKVAVLNQGLVQQLAPPAQIYSDPANQFVAGFVGSPQM
NLLTLPCQGPYAVLGSTKIPLPDNLTPPPEIVLGIRPENLRFPQPGDDLKVEGRVFLVEN
LGMSNLISMEVKGEGQKAEIVRALVPIDQSWSGDHVALALVPSAIYWFDVKSGDRVG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactagaaattcgtaacctcaataaaacttataatcgcaaaacggttccggtc
aaagatatcagtcttgatgttagcgacaatgaatttctgacgcttttggggccttcaggc
tgcggcaaatccacgactctgagactaattgctggtctggaacagccaacgcgaggtcag
gttctgatcggctcccaggatgtcacgaatttgcggccgggcgatcgcaatatcgccatg
gtgtttcagagctatgcgctgtatccacacatgagcgtgtttgagaatatggcctctagc
ctgaagctgcgcaaaactccctcggatgagatccatcagcgaattggagacgcgacgcgg
gtgctcggcctcgaaggcctgatggatcgcaagccgagccagctctccggcgggcagcgt
cagcgggtagccctggggcgggcgcttgtgcgccgtccagatgtctttctgttagatgag
cccctgagtaacctggatgccctgctgcgggagcgggtgcgggctgacatcaagcagctg
tttgagtctcagcaggtgccggtggtctacgtgacccacgaccaaaccgaggccatgacg
ctgtcgacaaaggtagctgtgctgaatcagggactggtgcagcagctcgcgccgccagcc
cagatctactctgatccggccaatcagtttgtggcgggctttgtgggtagtccccagatg
aacttgctgacgctcccctgccagggaccctacgcggtgctgggctccaccaagatccca
ttgcctgataaccttacgccgccgccggagattgtgctggggattcgccccgaaaatctc
cgctttcctcagcccggcgatgatctaaaagtcgaggggcgcgtattcttggtggaaaac
ttggggatgagcaatctcatcagcatggaagtaaaaggagagggtcaaaaagctgagatc
gtgcgggctctggtgccgatcgaccagtcttggagcggagaccacgtagctctggcgctc
gtgccatctgcgatctattggtttgatgtcaaatcgggcgatcgcgtgggctag

DBGET integrated database retrieval system