KEGG   Geitlerinema sp. PCC 7407: GEI7407_2229Help
Entry
GEI7407_2229      CDS       T02366                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  
L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GEI7407_2229
   00051 Fructose and mannose metabolism
    GEI7407_2229
Enzymes [BR:gei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     GEI7407_2229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2750721..2751776)
Genome map
AA seq 351 aa AA seqDB search
MKAQVFRGVNQLSYEEVPKPELGDDEVLVQVRVVGLCQSDIKKILYPLYEPPRIFGHETA
GTIAAVGKDVKGWQVGQRVVVLHHIPCMHCDYCLNDNFSMCDVYKNITTSAGFTPSGGGF
ADYVKVPGHIVRHGGLMEIPDEITFEQASFVEPTNCCLKAVKKAQVQPGQTVLVTGAGPI
GLMFVMLVKYFGGRAIATDLLPSRIAKAKEVGAEAAFDARDPELAQKIQALTNGMGVDTT
LLAVPSDKAFFQALDCTRKGGKILFFAEFPDEVEIPINPNVLYRREIDLMGSYSSSYRLQ
NLAADIVFNKRIDVDALVSDRYPLKDLAAAVERAVKPTEETYKILIYPELG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcaggtatttcgcggtgtgaatcagctcagctatgaagaggttcccaagcct
gagctaggagatgacgaagtgctcgtccaggtccgcgtggtaggcctgtgccagtcggac
atcaaaaaaattctctatccgctgtatgagccgccccggatttttggtcatgagacagcg
ggcacgatcgccgcagtgggcaaagacgtcaaaggatggcaagtcggtcagcgcgtggtg
gtgctccaccacatcccctgtatgcactgcgactactgtctcaatgacaatttctcgatg
tgtgatgtctacaaaaacatcacgacttccgcaggcttcacgcccagtggtggcggcttc
gcggactatgtgaaggtgccgggacatatcgtgcgccatggtggcctgatggagatcccg
gacgagatcaccttcgagcaggccagctttgtggagccgaccaactgctgcctgaaagcg
gtcaaaaaagcccaggtgcagcccggccagacggtgctggtgacgggggctggtcccatt
ggtctgatgtttgtgatgctggtgaaatactttggtggacgcgcgatcgcgacagatctc
ctgccctcgcgcattgccaaagccaaagaagtcggcgcagaggcagcctttgacgcgcgc
gatccggagctagctcaaaagatccaggctctcaccaatggcatgggcgtcgatacgacg
ctgctggcggtgcccagtgataaggcctttttccaggcgctggactgcacgcgcaagggt
ggaaagattctcttctttgcggagttcccggatgaagtggagatccccatcaatcccaat
gtcctctatcgccgagaaatcgacctgatgggcagctacagctcgtcttaccgcttgcaa
aacctggctgcggatattgtctttaataagcgcattgatgtagatgcgctggtgagcgat
cgctatccgctcaaggacttggccgcagcagtggagcgtgctgtgaagcccacagaggag
acctacaagatcttgatctatccggaattgggatag

DBGET integrated database retrieval system