KEGG   Geitlerinema sp. PCC 7407: GEI7407_2234Help
Entry
GEI7407_2234      CDS       T02366                                 

Definition
(GenBank) transcriptional regulator
  KO
K09012  
DeoR family transcriptional regulator, suf operon transcriptional repressor
Organism
gei  Geitlerinema sp. PCC 7407
Brite
Transcription factors [BR:gei03000]
 Prokaryotic Type
  Helix-turn-helix
   DeoR family
    GEI7407_2234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2755950..2756600)
Genome map
AA seq 216 aa AA seqDB search
MATSQHPSTKQDILQRLLKQGQATAQELAETLEISPQAIRRHLKDLEAEGLIQYQSVQAG
MGRPQHVYQLSRQGRDRFPDRYGEFAMSLLDTLAQTVGQEQVSSILRKQWERKAQEYRDR
LHNGGSVRDRVALLVELRRAEGYMAEWYPADASGDEAEGYVITEYNCAISDIAESFPSVC
GHELEMFSAALPDCAVERTHWLIDGEHRCGYLIRAR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttcgcagcatccttctactaagcaagatatcctccaacgtttgctgaagcag
ggtcaagcgacggcccaggaactggctgagacccttgagattagtcctcaggcgatccgt
cgccacctaaaggatctggaggcggaggggctgatccagtaccagagtgtgcaggcgggg
atgggccgaccgcagcacgtgtatcagctgagtcgccaggggcgcgatcgctttcccgat
cgctacggggagtttgcgatgtcgctgctggacacgctggcgcagacggtgggccaggag
caggtgagcagcattttgcgcaagcagtgggagcgcaaggcccaagaatatcgcgatcgc
ctgcacaatgggggctcggtgcgcgatcgcgtggcgctgctggtggagttgcggcgggcc
gagggctatatggcggagtggtatccggccgatgccagcggcgatgaagcagagggctac
gtcattacagaatacaactgcgcgatttctgatattgcggagtcgtttccgagcgtgtgc
ggccacgagctagagatgtttagcgcggcgctgcctgactgcgcggtggagcgaacgcac
tggctgatcgacggggagcaccgctgcggctatttgatccgggcgcgctaa

DBGET integrated database retrieval system