KEGG   Geitlerinema sp. PCC 7407: GEI7407_2236Help
Entry
GEI7407_2236      CDS       T02366                                 

Definition
(GenBank) Iron-regulated ABC transporter membrane component SufB
  KO
K09014  
Fe-S cluster assembly protein SufB
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2757367..2758803
Genome map
AA seq 478 aa AA seqDB search
MTTTLKNVVNQPYKYGFVTDIETDSIARGLNEDVIRLISAKKNEPEFMLEFRLKAYRQWL
KMEEPTWPHVSYPPINYQDIVYYSAPKQKEKLGSLDEVDPKLLETFEKLGIPLSEQKRLS
NVAVDAIFDSVSVATTFKEKLAEEGVIFCSISEALHQHPELVKKYLGTVVPVADNYFAAL
NSAVFTDGSFVFIPKGVKCPMDLSTYFRINNGDSGQFERTLIVAEEGASVTYLEGCTAPM
FDTNQLHAAVVELVALDNAEIRYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKISWT
QVETGSAITWKYPSCVLAGDNSVGEFYSVALTNNCQQADTGTKMVHIGKNTRSTIISKGI
SAGRSKNSYRGLVKVNPSAEGARNYSQCDSMLIGDSAEANTFPYIQVQNNTGRVEHEAST
SKIGEDQLFYFQQRGISTEDAVSMIISGFCKDVFNKLPMEFAVEADRLLSLKLEGSVG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacccttaaaaacgttgttaatcagccttacaaatacggctttgtcaccgac
atcgaaaccgactcgatcgcccggggcctcaacgaagacgtcattcggctgatctcagcc
aagaaaaatgaacctgagttcatgctggagtttcgtctcaaggcctatcggcagtggctg
aagatggaggagcccacctggccccacgtcagctatccccccatcaactaccaagacatc
gtttactactccgctcccaagcaaaaggaaaagctgggcagcctcgacgaagtcgacccc
aaactgctggagacttttgagaagctgggcatccccctgtccgagcaaaagcgcctgtcc
aacgtcgccgttgacgcgatcttcgacagcgtgtccgtggccaccaccttcaaggagaag
ctggccgaggaaggcgtgatcttctgctccatttcggaggccctccaccagcaccccgaa
ctggtgaagaagtacctgggcacggtggtcccggtcgccgacaactattttgcggctctg
aactcggcggtgttcacggacgggtcttttgtgttcatccccaagggcgtgaagtgcccc
atggacctgtcgacctatttccggatcaacaacggcgattcaggtcagtttgagcggacg
ctgatcgtggccgaggaaggcgcttcggtgacctacctggaaggctgcaccgcgcccatg
tttgacaccaatcagctccacgccgcagtggtcgagctagtggccctggacaatgcggaa
attcgctactccacggtccaaaactggtacgccggcgacgaaaacggcaagggcggcatc
tacaacttcgtgacgaagcgaggcttgtgcaagggtgtcaactccaagatttcttggacc
caggtcgagacgggctcggcgatcacctggaagtatcccagctgcgtgctggccggggac
aactcggtgggtgagttttattcggtggcgctgacgaacaactgccagcaggccgacacg
ggcaccaagatggtgcacatcggcaagaacacccgcagcacgattatttctaaggggatc
tcggcgggccgctcgaagaacagctatcgcggcctggtgaaggtaaacccgagcgctgag
ggagcgcgcaactactcccagtgtgactcgatgctgatcggcgacagcgccgaggccaac
acgttcccctacatccaggtgcaaaacaacacggggcgggtggagcacgaggcttcgacg
tcgaagattggcgaagaccagctgttttatttccagcagcggggcatctcgacggaggac
gcggtgtcgatgatcatcagcggcttctgcaaggacgtcttcaataagctgccgatggag
tttgcggtggaggcggatcgcctgctgagtctgaagctggaaggatctgttggctaa

DBGET integrated database retrieval system