KEGG   Geitlerinema sp. PCC 7407: GEI7407_2239Help
Entry
GEI7407_2239      CDS       T02366                                 

Definition
(GenBank) cysteine desulfurase
  KO
K11717  
cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Selenocompound metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    GEI7407_2239
Enzymes [BR:gei01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     GEI7407_2239
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     GEI7407_2239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2761101..2762363
Genome map
AA seq 420 aa AA seqDB search
MTFTQARSLAEAVRKDFPILNQEVHGKPLVYLDNAATSQKPQAVLDALRHYYERDNANVH
RGVHTLSARATDAYEGAREKVARFVNAASSQEIVYTRNATEAINLVAYAWGQQNLGPGDE
IILSVMEHHSNLIPWQMVAQRTGAVLKFVGLDSNEGFDLEQYRALVGDRTKLVSVVHVSN
TLGCVNPVKEIAAIAHQHGARVLIDACQSVPHMPIDVQDIDCDWLVASGHKMCAPTGIGF
LYGKREVLRAMPPFLGGGEMIADVFLDHATYADLPHKFEAGTPAIGEAIALGAAVDYLMG
LGMDTIYAYEKELTRYLFDQLQPLSQVRIYGPKPAADGSGRAALASFTAGDVHPHDLSTI
LDQAGVAIRAGHHCTQPLHRHIQAQSTARASLYFYNTREEVDVFIAALNEAIEFFGGIFG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcacccaagctagaagcctcgcagaagcagtccgcaaagactttccgattctc
aatcaggaagtccacggcaagcccctggtctacctcgacaacgctgccacttcccaaaag
ccccaggcggtgctggacgcgctccggcactactatgaacgcgacaacgccaacgtccat
cggggcgtccataccctgagcgctcgggccaccgatgcctacgaaggggcgcgggagaag
gtcgcgcgctttgtgaatgcggcgtcgtcccaggagattgtctacacgcgcaacgcgacg
gaggcgatcaacttggtggcctacgcctggggacagcaaaatctggggccaggagacgaa
atcattctgtcggtgatggagcaccacagcaacctgattccgtggcagatggtagcccag
cggaccggggcggtgctgaagtttgtcggtctcgacagcaatgaaggctttgacttggag
cagtatcgcgctctggtgggcgatcgcaccaagctggtgtctgtggtccacgtttccaat
accctaggctgcgtcaatccggtgaaagaaatcgccgcgatcgcccatcagcacggggcg
cgggtgctcatcgacgcctgccagagcgtgccccacatgcccattgatgtccaagacatc
gactgcgactggctggtcgcctcgggccacaagatgtgcgcgccgaccgggatcggcttc
ctctacggcaagcgcgaggtgctgcgcgccatgccgccctttttgggcggcggcgaaatg
atcgccgatgtgttcctcgaccacgccacctacgcggacctgccccacaagttcgaagca
ggcactccggccatcggggaggcgatcgccctgggagccgccgtcgactacctaatgggc
ctaggcatggacaccatctacgcctacgaaaaagagctgacccgctatttgtttgaccag
ttgcagcccctctcccaggtgcgcatctatggtcccaaacccgccgccgacggcagcggt
cgagccgctcttgcctcctttactgcaggggacgtccatccccacgacctatcgaccatc
ctggaccaagcaggcgtcgccattcgggctggccaccactgcacccagcccctgcaccgc
cacatccaggcccagtccaccgcccgggctagcctctacttctacaacacccgtgaagaa
gtagacgtctttattgcggccctcaatgaggcgatcgagttcttcgggggcatcttcggc
tag

DBGET integrated database retrieval system