KEGG   Geitlerinema sp. PCC 7407: GEI7407_2241Help
Entry
GEI7407_2241      CDS       T02366                                 

Definition
(GenBank) photosystem I iron-sulfur protein PsaC
  KO
K02691  
photosystem I subunit VII
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Photosynthesis
Metabolic pathways
Module
Photosystem I
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    GEI7407_2241
Photosynthesis proteins [BR:gei00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Main subunits
    GEI7407_2241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2762617..2762862
Genome map
AA seq 81 aa AA seqDB search
MSHSVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKAGQIASSPRTEDCVGCKRCETACPT
DFLSIRVYLGAETTRSMGLAY
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgtcccattcagtcaagatctatgacacttgcattgggtgcacccaatgcgtgcgggca
tgccctacggacgtactagagatggtgccctgggatggatgcaaagctggacaaattgct
tcctcccctcggactgaagactgcgttggctgcaagcggtgcgagactgcttgccccacg
gactttttgagcatccgggtttatctcggcgcagagaccactcgcagcatgggcttggct
tactaa

DBGET integrated database retrieval system