KEGG   Geitlerinema sp. PCC 7407: GEI7407_2242Help
Entry
GEI7407_2242      CDS       T02366                                 

Definition
(GenBank) glutamine--fructose-6-phosphate transaminase
  KO
K00820  
glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GEI7407_2242
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GEI7407_2242
Enzymes [BR:gei01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     GEI7407_2242
Peptidases [BR:gei01002]
 Cysteine Peptidases
  Family C44
   GEI7407_2242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2763274..2765187
Genome map
AA seq 637 aa AA seqDB search
MCGIVGYIGTQAASGILLEGLRKLEYRGYDSAGIATVWDGELQCVRAKGKLYNLQEKLES
VATPSHIGIGHTRWATHGKPEEHNAHPHLDTDMRVAVVQNGIVENYRELRDALRSRGVEF
RSETDTEVIPHLIAEHLQALSPDENLPAGSRLLEAVRRTVNQLEGAFAIAVVSADYPNEL
VVARQQAPLSLGFGQGEFFCASDTPALIPHTRAVLTLDNGEMARLTSLGAEVYTFGGKRL
MKSPRLLNWNPVLVEKQGFKHFMLKEIYEQPGVVRTCLESYLNSQWQPETDSPEDGRSPL
TLGLSPDLYEDLERVQIVACGTSWHASLVGKYLIEQLAGIPTMVQYASEFRYSPSPLTPN
TLTIGVTQSGETADTLAALDMEQQRRADRPPEFRARLLGITNRPESSLGHLVPHIIDTHA
GIEIGVAATKTFLGQLMAFYGLALELAYRRKTLTPPQIAEIIAGLRQLPASIELILETQE
RYIEDLAHHFAETQDFIFLGRGVNFPIALEGALKLKEISYIHAEGYPAGEMKHGPIALLD
AKVPVVAIAVPGSVYDKVLSNAQEAKARDSRLIGVTATSDAHAAEIFDDMLPIPEVPELL
SPVLTVIPLQLLAYHIAARRGLDVDQPRNLAKSVTVE
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgtcggctacattggcacccaggcagccagcggaattctcctcgaagga
ttgcggaaacttgagtaccggggctacgattcggccggtatcgcgacggtctgggacggc
gagctccagtgcgtgcgggccaagggcaagctctacaaccttcaggaaaagctagagagc
gtcgccaccccctcccacatcggcattggtcacacccgctgggcaacccacggcaaaccc
gaggaacacaatgcccacccccacctcgacacggacatgcgcgtcgccgtggtccaaaac
ggcatcgtcgagaactatcgagagctgcgagacgcattacgcagccgcggcgtggagttt
cgctcggaaaccgacacggaagtcattccccacctgatcgccgagcacctgcaagcgctg
tcgcctgacgaaaatctgcccgccggatcgcggctcctagaggcggtgcggcgcaccgtc
aaccagctagagggggcgtttgcgatcgccgttgtgtctgccgactatcccaacgagctg
gtggttgcgcgccagcaggctcccttgtccctgggctttggccaaggggagtttttctgc
gcgtcagacaccccggccctgattccccacacccgggcggtcctgaccctcgacaatggc
gaaatggcccgcctcacctccctgggggcagaagtgtatacctttggcggcaagcgcctc
atgaagtcgccgcgcctgctgaactggaaccccgtcttggtggaaaagcagggcttcaag
cacttcatgctcaaggaaatctatgagcagcccggagtggtgcggacctgcctggagtcc
tatctcaacagtcagtggcagccagaaaccgactcccccgaagacgggcgatcgcccctg
accctgggtctgtcgccagacctctatgaagacctcgagcgcgtgcagatcgtcgcctgc
ggcaccagctggcacgccagcctggtcggcaagtacctgatcgagcagctcgctggcatc
ccgacgatggtccagtacgcctcggagtttcgctactctccctcgcccctgacgcccaac
accctgaccatcggcgtcacccagtccggcgaaaccgccgacacgctggcagctctggac
atggagcagcagcgccgcgccgatcgccccccggagtttcgcgcgcgcctcttgggcatc
accaaccgccccgagagctctctgggccacctggttccccacatcatcgatacccacgcg
ggcatcgagatcggcgtggccgccacgaaaactttcctcggccagctgatggctttctat
gggctggccctggagctggcctaccgccgcaagaccctcacgccgcctcaaatcgcggag
attattgctggtctgcgccagctgccagcttctatcgagctgatcctggaaacccaggag
cgctatatcgaggatctggcgcaccattttgctgaaacccaggacttcatcttcttgggc
cggggggtcaatttcccgatcgctctggagggagccctgaagctcaaggagatcagctac
atccacgcggagggttatccggctggggagatgaagcatggcccgatcgcgctgctggat
gccaaggtgccggtggtggcgatcgccgttccggggtcggtctacgacaaggtgctctcc
aacgcccaagaggccaaggcgcgggactccaggctgatcggggtcacggccaccagcgac
gcccacgctgccgagatctttgacgacatgctgccgattccggaggtgccggagctgctg
tcgccggtgctgacggtgattccactacagctcttggcgtaccacatcgcagctcgccga
ggcctcgacgtcgatcagccccgcaacctcgccaaatcagtcacagtcgagtag

DBGET integrated database retrieval system