KEGG   Geitlerinema sp. PCC 7407: GEI7407_2245Help
Entry
GEI7407_2245      CDS       T02366                                 

Definition
(GenBank) pentapeptide repeat protein
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2767058..2768287
Genome map
AA seq 409 aa AA seqDB search
MINSVQLFLLRMGIPIWNQWRSHFIGQIDFSKADLRDAYLSSADLTKVKLKDAKLDRAYL
PHADLSHADLSHANLSGANLSGANLSEAKLIGSDLTGANLTRTILSKTNFTGADLSNVNL
SKAQCSATIFSKATLTGSCLQDWILDTETQFFEVICDYFYGVEGCQKRRPQSSSFAPGEF
SALIHKVSDTIDLIFVDGIDWKPFLLSFQELRDKYGDANLSVQAIEKKKDEAFIIRLEVA
AEVNKTEIEKTLKQEYNYKLKAQEKLLTLQDQQLVEYRQHNTELLRIIRVMAEKEESRRN
INTGGGNYIESNSGGYAEGNYVNYINMNQNLTHAASQIQALIDQLQSQGMDVDVAKEKVA
ADIANQAKNNPSMQAKLLKWGQSVGNATVSDVVQGVVKLAIRSAGLPLP
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgataaattcagttcagttatttcttctgagaatgggtatacctatttggaatcagtgg
agaagccattttatagggcaaatcgatttcagcaaggcagatctgagagatgcttatctt
agtagtgctgacttaacaaaggtaaaactcaaagatgctaaacttgatagagcttatcta
cctcatgcagatctcagccacgcagatctcagtcatgccaacttgagcggggcaaacctt
tctggggctaacttaagtgaagcaaagttgattggctctgacctcaccggagcaaattta
accagaaccattttaagtaaaactaattttactggagctgatctttccaatgtcaatctc
agtaaagctcaatgctctgcaactatcttttccaaagcaacattgactggatcgtgtctt
caagactggattttagatactgaaacacaattttttgaagttatctgtgactatttttat
ggagtagaaggttgtcaaaaacgtcggcctcaatcttcctcttttgctcctggtgagttt
tcagcattaattcataaagtgtcagatacaattgatttgatttttgttgatggtattgat
tggaaaccctttcttctttcttttcaagaattgagagacaagtatggagatgctaatctc
tctgtacaagctattgaaaagaaaaaggatgaagctttcataattcgactagaggttgca
gcagaagtaaataagacggagatcgaaaaaacactaaagcaggagtataattacaaactt
aaagcacaagagaaactgttgacacttcaagatcagcaattggtagaatatagacagcac
aatacagaattattaaggattattcgagtaatggctgagaaagaagaatcgagaagaaat
attaacactggtggtggtaattatatcgaatctaactctggtggttatgctgagggaaac
tatgttaactacattaatatgaaccaaaatttgactcatgcagcttcccagattcaagct
ttgattgatcagttacaaagtcaaggaatggacgttgacgtggcaaaggagaaggttgcg
gcagatatagcaaatcaagctaaaaataatccgagtatgcaagccaagcttcttaagtgg
ggacaatccgtaggaaatgccacggtgagtgacgttgtacagggagttgtaaagctggct
attcgctctgctggtctccctctaccataa

DBGET integrated database retrieval system