KEGG   Geitlerinema sp. PCC 7407: GEI7407_2252Help
Entry
GEI7407_2252      CDS       T02366                                 

Definition
(GenBank) hypothetical protein
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2773944..2774375)
Genome map
AA seq 143 aa AA seqDB search
MRFKLLVSGLVTAAAIALSGTGAEAQTLMRTGLMRNVLVDALANRSTVFSSGVLADLETD
ENFGGDYQQIFDYASGILNDYTVVDRGGVFPENAGIPRDRQLPRTDVVYTVFTLDNGNEL
FLYRSPLEDTARYFIRESVPFGG
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcaaacttttggtgtcgggattggtcacggcagcggcgatcgctctatcgggg
actggcgctgaggctcagacgctgatgcggaccggcctgatgcgcaatgtgctggtcgac
gctttggccaaccgctcgacggtgttttcgagcggagtgctggcagacctggaaaccgat
gagaactttggtggggactatcaacagatttttgactatgccagcggcatcttgaatgac
tacacggtggtcgatcggggtggcgtcttccccgaaaatgccggcatcccccgcgatcgc
cagcttccccgcaccgacgtggtctataccgtcttcaccctcgacaacggcaatgaactc
ttcctctatcgctcgcccctcgaagacaccgcgcgctactttatccgcgaatcggttcct
tttggcggctaa

DBGET integrated database retrieval system