KEGG   Geitlerinema sp. PCC 7407: GEI7407_2253Help
Entry
GEI7407_2253      CDS       T02366                                 

Definition
(GenBank) carbonic anhydrase
  KO
K01674  
carbonic anhydrase [EC:4.2.1.1]
Organism
gei  Geitlerinema sp. PCC 7407
Pathway
Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:gei00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    GEI7407_2253
Enzymes [BR:gei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     GEI7407_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2774642..2775391
Genome map
AA seq 249 aa AA seqDB search
MTIRRSHIHQKFLQRLGRAIALLGLLWVAFGEPVWALTWSYQEPTDPAHWAEIDPAYKLC
ATGHTQSPVDLVTAKMGASVGASGDLTLDYGVAPSAVVEPGTTLQVRYPAGNQLTVGNQS
YGLQQFHFHVPSEHWIDHRPHAMEVHWVHRSEAGDLAVLAVLVDAGRENPALEQLWRSLT
DDTALAAFDGQSLLPHDLAHYRYSGSLTTPPCSEGVQWLVLSQPIQASAAQIARFTARYG
PNVRPLQRQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacgataaggcgatcgcacattcaccaaaaattccttcaacgcctgggacgggcgatc
gcacttttgggcttgctgtgggtggcttttggggagccggtttgggcgctgacctggagc
taccaggagcccaccgacccagcccactgggccgagatcgacccggcctacaagctgtgc
gccacgggccatacccaatcccccgttgatctggtgacggccaaaatgggcgcttctgta
ggcgcttctggggatctcaccttggactatggcgtcgcacccagcgctgtcgtggagccc
ggcaccacgcttcaggtgcgctatcccgctggcaatcagctcacagttggcaaccagtcc
tacggcctccaacaatttcatttccacgtccccagcgagcactggatcgatcaccggccc
cacgccatggaggtgcactgggtccatcgcagcgaggcaggggatctggctgtgctggcc
gtgctggtggacgcggggcgcgaaaatcctgccctagagcagctgtggcgatcgctcacc
gatgacaccgcactggcggcctttgacgggcaatcgctgttgccccatgacctagcgcac
taccgctacagcggctctttgaccacgccgccgtgctccgaaggggtccagtggctcgtg
ctgagccagccgatccaggcatctgccgcccagatcgctcgcttcaccgcccgctacggc
ccaaatgtccgacccttgcagcggcaatag

DBGET integrated database retrieval system