KEGG   Geitlerinema sp. PCC 7407: GEI7407_2257Help
Entry
GEI7407_2257      CDS       T02366                                 

Definition
(GenBank) multi-sensor signal transduction histidine kinase
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2778211..2782071
Genome map
AA seq 1286 aa AA seqDB search
MSELLDLTNVSVSSLLQTQPLTATPDTTVASAIAQMHRQQARYVLVTQDQVLHGILTEND
VVRALASGQSLATLRVVDLMDAEVITLAEADLESLLEVLHKLQAYGVPHLPVVNDQGHPI
GVISRTALRGMLKPLDLLRFRRVAEVMGSPGLYAQAEQPLQQIVQMMAQDSASFVVIVGS
ASPPMAGAQGRLQPLSPVGIITEHDVLRWYARRVNFATTLAQDVMSAPVLTIGSEASLGE
VHAAMQHHQIQQLVVTGDRGEWVGTITQTRVLSAYDPVEMHLLIAELQQTVQHQAADLEH
EKQQRQSLQQSLADYEARYHSILNNLPDLVSCCQPDGTLTFVNQAYCNYFQRSPEALLGQ
SFLSFIPPEDHALVQSSLQRLAETCQSLLCEHRITAPDGTLRWHQWNNQVVCDAQGNILE
IQSVGRDITTFKQAEASLKANETRFRALVQNSFDILQLMDAEFNVLYTNPALERILGPLP
QPFTSHALCRQLHEEDAPLMHRVMAASLGQPETPLTVQYRMRRTDGSWVWIETVLTNWLH
HPDVRAIVLNSRNISEHKATEEALHQREREFRALVENAPDVIARFNQRCEFLYINPRVEQ
TTGIPPHRFIHQTPQALGFPGHIVQLWDQTVASVYQTGQEEVVEYQCSSPDHPPRYYSAR
IVPEFGDRHQVESVLMVARDVTQRRLAEAAVLRQAQREKALNRVIQAIHHSLDVSTLFAT
AVRSVTELLESEQTVLTQFLPEQRLWRNVAWHGANAEAPDLTGREVSEVQALALRRLQYL
EALPLLSGKRVGGLWGEAESPPKTAQTWLVVRIYLHRLWGCLALRRSHQPWQESEIELTQ
TIANQLAIAVEQSELYIQVHRLNATLERQVKARTAQLEMAFDFEASLKRITDRVRDSLDE
SHILQTAVEELAQCLGVNCCNAALFDLEKDTSTICYEHVSAGVSPYRGRISRLKDFPELY
EPLLRGEHFQFCSIMPNPLRGRVAMLACPIQDDKGVMGDLWLVKQSYHAFSDQDIRLVQQ
VANQCAIALRQAQLYQAAQAQVQELERLNHLKDDFLSSVSHELRTPMSNMRMAIQMLEVS
LRPTGLLEASETPHRYFRILKEECSRETNLINDLLDLARLDAHHEPLVLNTLRLQRWIQK
VIEPFMSRFQQQQQTLINELPADLPPLTTDFFHLERVLGELLQNACKYTPAQESIRLSAQ
VVPEGMAIHVCNSGVDIPEAELAHVFDKFYRVPKNDPWKHGGTGLGLALVKKLTEHLNGT
IAAHSGDRWTCFTVTLPNLDPPRPVE
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaattgctcgatttgacgaatgtttctgtttccagtcttcttcaaactcaaccc
ttaacggccacgcctgataccacggtggcatcggcgatcgcccaaatgcaccgacagcaa
gctcgctacgtcctcgtgacccaagatcaggttctccacggcatcctcacagaaaacgac
gtcgtgcgcgccctggcctctggacagtccctggcaacgttgcgcgtcgtggatctgatg
gatgcggaggtgatcaccctcgctgaggccgatctcgagagcctgctggaggtgctgcac
aagcttcaggcctatggggtaccccatttgccggtggtcaatgaccagggacatcccatt
ggcgtgatctcgcggacggcgctgcgcgggatgctcaagccgctggatctgctgcgcttt
cggcgggttgctgaggtgatgggctcccccggactctacgcccaggccgagcagcccctc
cagcaaattgtccagatgatggcccaggattcagccagttttgttgtgattgtgggttcc
gcttcgcccccgatggccggagcccaagggcgcttgcagccgttgagtcccgtcgggatc
atcactgagcacgatgtgctgcgctggtacgctcggcgggtaaattttgcgacgaccctg
gctcaggacgtgatgagcgctccggttttgacgatcggatctgaggcttctttgggggaa
gtccacgcagcgatgcagcatcaccaaattcagcagctggtcgtgacgggcgatcgcggc
gagtgggtggggacgatcacgcaaactcgggtcttgagcgcctatgacccggtcgagatg
cacctgctgatcgccgagttgcagcaaacggtccaacatcaagcggccgatctcgaacac
gaaaagcagcagcggcagagcctccagcaatctttggccgattatgaggcacgctaccac
agcattttgaataacttgccggatttggtgtcctgctgccagcccgacggcaccttgacc
tttgtcaatcaggcctactgcaactactttcagcgatcgcccgaagcgctgctcggccag
agctttctctccttcattccccccgaggaccacgccctcgtccagagcagcctccagcgc
ctcgccgaaacctgccagtcactgctctgcgagcaccgcatcacggcccccgacggcacg
ctgcgctggcatcagtggaacaatcaggtcgtttgcgacgcccagggcaacatcctagaa
atccagtccgtcgggcgagacattacgacgttcaagcaggccgaggcctccctcaaggcc
aatgaaactcggtttcgcgccctggtgcagaactccttcgacatcctgcagctgatggat
gccgagtttaacgtgctctataccaatcccgccctggagcgtatcctcggccccctgcct
cagcccttcacgtcccacgctctctgccgccagctccacgaagaagacgctcccctgatg
catcgggtgatggccgccagcctggggcagcccgagaccccattaaccgttcagtaccgc
atgcggcggaccgacggctcctgggtctggatcgagactgttttgaccaactggctccat
catccggacgtccgggcgatcgtcctcaactcccgcaacatcagcgagcacaaagccaca
gaggaggcgctgcaccagcgggagcgagagtttcgcgccctggtcgaaaatgcgcccgac
gtgatcgcccgcttcaatcagcgctgcgagtttctctatatcaatccccgagtcgagcag
accacgggcattccgcctcaccgatttatccatcagacccctcaggcgctgggctttccg
ggccatattgtgcagctgtgggaccagaccgtcgcgtcggtctaccagacgggccaagaa
gaggtagtggagtatcagtgcagctcccccgatcaccccccgaggtactactctgcgcgg
atcgtgccggagtttggcgatcgccatcaggtcgagtcggtgctaatggtggcccgggat
gtcacccagcgccgtctcgccgaagcagccgtcctgcggcaggcccagcgagagaaggcc
ctcaaccgggtgattcaggcgatccatcattcgctggatgtcagcaccctgtttgcgacg
gcggtgcgatcggtgacggagctgctggaaagcgagcaaacggtgctgacccagtttctg
ccggagcagcggctctggcgcaacgtggcctggcacggggccaacgccgaggcacccgat
ctgacgggccgagaagtcagcgaggttcaggcgcttgccctgcggcggttgcagtatctg
gaggcgctgcccctgctctctggcaaacgggtgggcggactgtggggcgaggcggagtcc
ccgccaaaaactgcccaaacttggctggttgtgcggatttatctgcatcgactgtggggc
tgtctggcgctgaggcgatcgcaccagccctggcaggaaagcgagatcgagctgacccag
accattgccaatcagttggccatcgccgtggagcagtccgagctctacatccaggtgcac
cgcctcaacgccaccctcgagcgccaagtcaaggcccgcacggcccagctggaaatggcc
tttgacttcgaggcgtccctcaagcggatcaccgaccgggtgcgcgacagcctcgacgag
agccacatcttacagaccgccgtggaggagctggcccagtgcctgggggtcaactgctgc
aacgcagcgctttttgatctagaaaaagacacctccaccatctgctatgagcacgtcagc
gctggtgtatcgccctatcgcggtcgcatctcgcgcctcaaagacttcccggagctttat
gaaccccttttgcggggtgagcatttccagttttgctcgatcatgcccaatcccctgcga
ggccgcgtggccatgctggcctgcccgatccaggatgacaagggggtgatgggcgatttg
tggctggtcaagcagagctaccacgccttcagcgaccaagatattcggctggtccagcag
gtagccaaccagtgcgcgatcgccctgcgccaggcccagctctaccaagcggcccaggcc
caggtacaggagctcgagcggctcaatcatctcaaagacgacttcttgagcagcgtgtcc
cacgagctgcgcacccccatgtccaacatgcgcatggccattcagatgctggaggtgtct
ctgcgacccacgggcctgctggaggccagcgaaacgccccatcgctattttcggattctc
aaggaggaatgtagccgcgaaaccaatctgatcaacgacctgctggatttggcccgcctc
gatgcccaccacgagcccctcgtcctcaacaccctgcgcctccagcgctggatccaaaag
gtgatcgagcccttcatgagccgctttcagcagcagcagcaaaccctgatcaatgagctg
ccagcagatttgccgcccctgaccacggattttttccacctcgagcgggtgctcggggag
ctgctgcaaaacgcctgcaagtacacgccagcccaggagagtattcgcctgtcggcgcag
gtggttccagagggcatggccattcacgtctgtaactcgggcgtggacatcccagaggcc
gagctggcccacgttttcgacaagttttaccgggtgccgaaaaatgacccctggaagcac
gggggcacgggactggggctggccctggtgaaaaagctgacggagcacctaaatgggacc
attgcggctcacagtggcgatcgctggacctgctttacggtgacgctgccaaatctggac
ccgccgcggccggtcgaatag

DBGET integrated database retrieval system