KEGG   Geitlerinema sp. PCC 7407: GEI7407_2263Help
Entry
GEI7407_2263      CDS       T02366                                 

Definition
(GenBank) homodimeric phycobilin lyase, CpcS-III family
Organism
gei  Geitlerinema sp. PCC 7407
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2788905..2789465
Genome map
AA seq 186 aa AA seqDB search
MDIVEFFDLSAGKWFSQRTSHHLAFKQSEAGKSELQIDMLAKDDPAVIQLCEQYSFDPAE
ALCGARVTWTGTMEWDKEKHEGSTVLVPVADPNNPMEGKLLRELGYAEKAPVAGRYVMGS
DEALTLITEYETMYSEERLWFASPNLRLRTSILKRFGGFSMASFCSEIRTGNLKPMPSTD
AATANS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggatatagttgaattttttgacctgagtgctggcaagtggttttcgcaacgcacgagc
caccacctcgccttcaaacagtcagaagctggaaaatctgaactccaaattgacatgttg
gcgaaggatgatcccgcagtgattcaactgtgtgagcagtacagcttcgatcctgctgaa
gccctgtgcggggctcgggtgacctggaccggcaccatggaatgggacaaggaaaagcat
gaaggctctacggtgttggtaccggtggccgatcccaacaaccccatggaaggtaagctg
ctgcgggagctgggctatgccgagaaggcaccggtggccggccgctacgtgatgggcagc
gatgaagcgctgaccctgatcacggagtacgagacgatgtactcggaggagcgtctgtgg
ttcgccagccccaatctgcgcctgcgcaccagcattctgaagcggttcgggggctttagc
atggcgtctttttgctccgagatccgcaccggcaatctgaagcccatgccgtcgacggac
gcagccacagccaattcctag

DBGET integrated database retrieval system